UniGene Name: sp_v3.0_unigene69503
Length: 241 nt
UniGene Fasta |
---|
>sp_v3.0_unigene69503
C |
Ace file of the UniGene sp_v3.0_unigene69503 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | alanyl-tRNA synthetase [Arabidopsis thaliana] sp|Q9FFC7.2|SYAP_ARATH RecName: Full=Probable alanyl-tRNA synthetase, chloroplastic; AltName: Full=Alanine--tRNA ligase; Short=AlaRS; AltName: Full=Protein EMBRYO DEFECTIVE 1030; AltName: Full=Protein EMBRYO D | - | - | 4.0e-18 | 61% |
FL-Next | sp=Probable alanine--tRNA ligase, chloroplastic; Sorghum bicolor (Sorghum) (Sorghum vulgare). | - | - | 0.0 | 75% |
Source | Gene names |
---|---|
Sma3 | GSVIVT00036226001; OsI_22356; OsJ_20798; PHYPADRAFT_174459; POPTRDRAFT_821063; RCOM_0235110; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | alanine-tRNA ligase activity | GO:0004813 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ligase activity, forming aminoacyl-tRNA and related compounds | GO:0016876 | Molecular Function | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | alanyl-tRNA aminoacylation | GO:0006419 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | tRNA aminoacylation | GO:0043039 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alanyl-tRNA synthetase, class IIc | IPR002318 | - | 0.0 | - |
Sma3 | Phosphoesterase, DHHA1 | IPR003156 | - | 0.0 | - |
Sma3 | Threonyl/alanyl tRNA synthetase, SAD | IPR012947 | - | 0.0 | - |
Sma3 | Alanyl-tRNA synthetase, class IIc, N-terminal | IPR018164 | - | 0.0 | - |
Sma3 | Alanyl-tRNA synthetase, class IIc, core domain | IPR018165 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G22800.1 | EMB86, EMB1030, EMB263 Alanyl-tRNA synthetase, class IIc chr5:7616221-7619961 REVERSE LENGTH=978 | 5.0e-23 | 69% |
RefSeq | Arabidopsis thaliana | NP_680210.2 | alanyl-tRNA synthetase [Arabidopsis thaliana] | 7.0e-23 | 69% |
RefSeq | Populus trichocarpa | XP_002313683.1 | predicted protein [Populus trichocarpa] | 1.0e-26 | 72% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: sp_plants
Fln subject: C5Z7K4
Fln msg: STOP codon was not found. Distance to subject end: 8 aas, your sequence is shorter than subject: 80 - 961
Fln protein:
R
Protein Length:
81
Fln nts:
C
Fln Alignment:
GG46A6U01CNF9A___SIVLGSCPGDGKVSFVAAFSPKIIESGLQAGKFVGTVARLCXXXXXXRPNFAQAGGRKPEKLIDALEKARADL
C5Z7K4_______________AVILGSSPGDGKVSLVAAFSPAVVKMGLQAGKFVGGIAKLCGGGGGGKPNFAQAGGRKPENLPDALEKARAEI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain