|
||||||
|
UniGene Name: sp_v3.0_unigene69489
Length: 167 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene69489
C |
|
Ace file of the UniGene sp_v3.0_unigene69489
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Peroxidase n=1 Tax=Picea abies RepID=Q5W5I4_PICAB | - | - | 5.0e-11 | 74% |
| FL-Next | tr=Peroxidase; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 74% |
| Sma3 | Peroxidase | - | - | 5.099e-22 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 2.082e-20 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 2.082e-20 | % | |
| Sma3 | Methane metabolism | 00680 | 2.082e-20 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 2.082e-20 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 2.082e-20 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.082e-20 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.082e-20 | % |
| Source | Gene names |
|---|---|
| Sma3 | FLXPER3; GSVIVT00031723001; POPTRDRAFT_1078828; POPTRDRAFT_714789; POPTRDRAFT_830144; RCOM_0960960; ca-pox1; prx1; prx2; prxr1; prxr3; px2; px3; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G71695.1 | Peroxidase superfamily protein chr1:26964359-26966557 FORWARD LENGTH=358 | 2.0e-12 | 61% |
| RefSeq | Arabidopsis thaliana | NP_177313.1 | peroxidase 12 [Arabidopsis thaliana] | 3.0e-12 | 61% |
| RefSeq | Populus trichocarpa | XP_002306716.1 | predicted protein [Populus trichocarpa] | 2.0e-15 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q5W5I4
Fln msg: Distance to subject end: 35 aas, your sequence is shorter than subject: 55 - 353
Fln protein:
V
Protein Length:
56
Fln nts:
C
Fln Alignment:
GG46A6U01CELOO___LFTSDQDLYTHSSTRAIVKKFADDQDLFFQKFAFAIVKMSQLSVLTG
Q5W5I4_______________LFTSDQDLYSDSRTKAIVNDFALDQDLFFEKFAVAMVKMGQLNVLTG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
