UniGene Name: sp_v3.0_unigene69460
Length: 233 nt
UniGene Fasta |
---|
>sp_v3.0_unigene69460
C |
Ace file of the UniGene sp_v3.0_unigene69460 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Thiamin pyrophosphokinase, putative n=1 Tax=Ricinus communis RepID=B9SAN6_RICCO | - | - | 7.0e-18 | 65% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
Sma3 | Thiamin pyrophosphokinase, putative | - | - | 7.149e-09 | - |
Source | Gene names |
---|---|
Sma3 | AT1G02880; At1g02880; B1157F09.24; GSVIVT00027976001; OSJNBa0052O12.42-1; OSJNBa0090H02.18; Os01g0356500; Os01g0931400; Os05g0367400; OsI_01865; OsI_05056; OsJ_01724; OsJ_04650; OsJ_18271; P0025H06.10; P0506E04.20-1; POPTRDRAFT_572707; POPTRDRAFT_816675; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | thiamine diphosphokinase activity | GO:0004788 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | kinase activity | GO:0016301 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | mismatched DNA binding | GO:0030983 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | mismatch repair | GO:0006298 | Biological Process | 0.0 | - |
Sma3 | thiamine metabolic process | GO:0006772 | Biological Process | 0.0 | - |
Sma3 | thiamine diphosphate biosynthetic process | GO:0009229 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G02880.3 | TPK1 thiamin pyrophosphokinase1 chr1:643063-644485 REVERSE LENGTH=267 | 4.0e-21 | 62% |
RefSeq | Arabidopsis thaliana | NP_001117219.1 | thiamin pyrophosphokinase1 [Arabidopsis thaliana] | 2.0e-21 | 62% |
RefSeq | Populus trichocarpa | XP_002320349.1 | predicted protein [Populus trichocarpa] | 3.0e-23 | 63% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LN96
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 33 aas, your sequence is shorter than subject: 71 - 230
Fln protein:
R
Protein Length:
72
Fln nts:
C
Fln Alignment:
GG46A6U01ESNY5___HSFLNIRIVLLSNHSLVYLLPKTHCHEILIDHSVEGPHCGLVPVAAPSQSTTTSGLQWDLN
B8LN96_______________YTFSNIRIVLLSNHSLVYLLPKTHRHEILINHSVEGPHCGLAPVAAPSQSTTTSGLQWDLN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain