UniGene Name: sp_v3.0_unigene69205
Length: 227 nt
UniGene Fasta |
---|
>sp_v3.0_unigene69205
C |
Ace file of the UniGene sp_v3.0_unigene69205 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative serine/threonine phosphatase [Leymus triticoides] | - | - | 8.0e-15 | 61% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
Sma3 | Putative serine/threonine phosphatase | - | - | 7.641e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoprotein phosphatase. | EC:3.1.3.16 | - | 1.884e-13 | - |
Source | Gene names |
---|---|
Sma3 | ACRE284; AP3_H09.2; At1g07160; At1g67820; At2g30020; At2g40180; At3g27140; At4g08260; F10K1.13; F12A21.5; F23F1.6; GSVIVT00024072001; GSVIVT00029318001; LOC_Os03g18150; MP2C; MYF5.1; NbP2C; Os03g0292100; OsI_11115; OsJ_10455; POPTRDRAFT_719882; POPTRDRAFT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | protein serine/threonine phosphatase complex | GO:0008287 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine phosphatase activity | GO:0004722 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | protein dephosphorylation | GO:0006470 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | defense response to fungus | GO:0050832 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein phosphatase 2C, manganese/magnesium aspartate binding site | IPR000222 | - | 0.0 | - |
Sma3 | Protein phosphatase 2C-like | IPR001932 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | IPR014045 | - | 0.0 | - | |
Sma3 | Protein phosphatase 2C | IPR015655 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G40180.1 | ATHPP2C5, PP2C5 phosphatase 2C5 chr2:16782522-16784014 FORWARD LENGTH=390 | 1.0e-19 | 59% |
RefSeq | Arabidopsis thaliana | NP_181547.1 | putative protein phosphatase 2C 30 [Arabidopsis thaliana] | 2.0e-19 | 59% |
RefSeq | Populus trichocarpa | XP_002311236.1 | predicted protein [Populus trichocarpa] | 3.0e-20 | 65% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NM48
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 44 aas, your sequence is shorter than subject: 75 - 338
Fln protein:
S
Protein Length:
76
Fln nts:
C
Fln Alignment:
GG46A6U01D3D6R___GDSHMKQWITAEPETRNIEITSDCEFLILASDGLWNTVTNQEAVDIARPFCVEKQPNLTP
A9NM48_______________GDLHMKEWITAEPDTRKIEITSDCEFLILASDGLWDKVTNQEAVDIARPFCVQKQPNLTP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain