UniGene Name: sp_v3.0_unigene69144
Length: 230 nt
![]() |
---|
>sp_v3.0_unigene69144
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | alpha-L-fucosidase 3 [Arabidopsis thaliana] sp|Q9FXE5.1|FUCO3_ARATH RecName: Full=Alpha-L-fucosidase 3; AltName: Full=Alpha-1,2-fucosidase; Short=AtFXG1; AltName: Full=Alpha-L-fucoside fucohydrolase 3; Flags: Precursor gb|AAG28886.1|AC008113_2 F12A21.4 [A | - | - | 4.0e-23 | 86% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
Sma3 | Alpha-L-fucosidase 2, putative | - | - | 1.306e-20 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Hydrolases, Acting on ester bonds, Carboxylic ester hydrolases. | EC:3.1.1.- | - | 7.068e-13 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ascorbate and aldarate metabolism | 00053 | 7.068e-13 | % | |
Sma3 | Bisphenol degradation | 00363 | 7.068e-13 | % | |
Sma3 | Glycerophospholipid metabolism | 00564 | 7.068e-13 | % | |
Sma3 | Toluene degradation | 00623 | 7.068e-13 | % | |
Sma3 | Aminobenzoate degradation | 00627 | 7.068e-13 | % | |
Sma3 | Retinol metabolism | 00830 | 7.068e-13 | % | |
Sma3 | Tropane, piperidine and pyridine alkaloid biosynthesis | 00960 | 7.068e-13 | % |
Source | Gene names |
---|---|
Sma3 | At1g09390; At1g67830; At3g26430; At3g27950; At4g01130; At5g14450; ENOD8; EP4a; EP4b; Enod8.1; Enod8.2; F12A21.4; F14J9.5; F18O22.240; F20C19.19; F2N1.17; FXG1; GSVIVT00015390001; GSVIVT00015391001; GSVIVT00020632001; GSVIVT00020633001; GSVIVT00020634001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | alpha-L-fucosidase activity | GO:0004560 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, acting on ester bonds | GO:0016788 | Molecular Function | 0.0 | - |
Sma3 | IgE binding | GO:0019863 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | lipid metabolic process | GO:0006629 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Lipase, GDSL | IPR001087 | - | 0.0 | - |
Sma3 | Histone H2A | IPR002119 | - | 0.0 | - |
Sma3 | Lipase, GDSL, active site | IPR008265 | - | 0.0 | - |
Sma3 | IPR015706 | - | 0.0 | - | |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G67830.1 | ATFXG1, FXG1 alpha-fucosidase 1 chr1:25431705-25432972 REVERSE LENGTH=372 | 6.0e-30 | 86% |
RefSeq | Arabidopsis thaliana | NP_176949.1 | alpha-L-fucosidase 3 [Arabidopsis thaliana] | 8.0e-30 | 86% |
RefSeq | Populus trichocarpa | XP_002314590.1 | predicted protein [Populus trichocarpa] | 7.0e-32 | 79% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0U3
Fln msg: Distance to subject end: 225 aas, your sequence is shorter than subject: 76 - 326
Fln protein:
R
Protein Length:
77
Fln nts:
C
Fln Alignment:
GG46A6U01D1241___AEDDCEFPAIFNFGDSNSDTGGLSAAFGAAPPPNGESFFHKPAGRYCDGRLVIDFIAERL
A9P0U3_______________SQGKCAFPAIFNFGDSNSDTGGFYAAFPAESPPYGMTFFNKPAGRASDGRLVVDFLGKNL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain