UniGene Name: sp_v3.0_unigene68885
Length: 178 nt
UniGene Fasta |
---|
>sp_v3.0_unigene68885
C |
Ace file of the UniGene sp_v3.0_unigene68885 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Glyco_hydro_16 domain containing protein | - | - | 2.0e-12 | 49% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Source | Gene names |
---|---|
Sma3 | GSVIVT00011620001; GSVIVT00012496001; PHYPADRAFT_108715; PHYPADRAFT_112374; PHYPADRAFT_112531; PHYPADRAFT_140590; PHYPADRAFT_191788; PHYPADRAFT_225086; RCOM_1719370; VITISV_032683; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | xyloglucan:xyloglucosyl transferase activity | GO:0016762 | Molecular Function | 0.0 | - |
Sma3 | cellular glucan metabolic process | GO:0006073 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, family 16 | IPR000757 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 16, active site | IPR008263 | - | 0.0 | - |
Sma3 | Beta-glucanase | IPR008264 | - | 0.0 | - |
Sma3 | Xyloglucan endo-transglycosylase, C-terminal | IPR010713 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
Sma3 | Xyloglucan endotransglucosylase/hydrolase | IPR016455 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G65730.1 | XTH6 xyloglucan endotransglucosylase/hydrolase 6 chr5:26299080-26300290 FORWARD LENGTH=292 | 4.0e-16 | 53% |
RefSeq | Arabidopsis thaliana | NP_569019.1 | xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana] | 5.0e-16 | 53% |
RefSeq | Populus trichocarpa | XP_002301792.1 | predicted protein [Populus trichocarpa] | 4.0e-16 | 59% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQP4
Fln msg: Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 130 aas, your sequence is shorter than subject: 53 - 293
Fln protein:
S
Protein Length:
54
Fln nts:
C
Fln Alignment:
GG46A6U01CVH9J___LSLKFLGTVPGQPYTLQTNVFANGSGKREQKINLWFHPMFSFHNYSIL*NEKQI
A9NQP4_______________LDYEFLGNLPGKPYTLQTNVFANGVGNREQKIRLWFDPTDDFHNYSIIWNHKQI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain