|
||||||
|
UniGene Name: sp_v3.0_unigene68860
Length: 241 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene68860
C |
|
Ace file of the UniGene sp_v3.0_unigene68860
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | AP2/ERF domain-containing transcription factor n=1 Tax=Populus trichocarpa RepID=B9N9M4_POPTR | - | - | 4.0e-12 | 67% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
| Sma3 | AP2/ERF domain-containing transcription factor | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | 24.t00032; 24.t00040; 25.t00062; 26.t00057; 27.t00030; 46C02.12; ACRE1; At1g04370; At1g06160; At2g31230; At2g44840; At3g23220; At3g23230; At3g23240; At4g17490; At4g17500; At4g18450; At5g43410; At5g47220; At5g51190; B1234D02.6; B1331F11.13; B1331F11.17; BI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
| Sma3 | jasmonic acid and ethylene-dependent systemic resistance | GO:0009861 | Biological Process | 0.0 | - |
| Sma3 | induced systemic resistance, jasmonic acid mediated signaling pathway | GO:0009864 | Biological Process | 0.0 | - |
| Sma3 | jasmonic acid mediated signaling pathway | GO:0009867 | Biological Process | 0.0 | - |
| Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
| Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
| Sma3 | GO:0045941 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Signal recognition particle, SRP54 subunit, GTPase | IPR000897 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | AP2/ERF domain | IPR001471 | - | 0.0 | - |
| Sma3 | Major facilitator superfamily | IPR011701 | - | 0.0 | - |
| Sma3 | DNA ligase, ATP-dependent, conserved site | IPR016059 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G23220.1 | Integrase-type DNA-binding superfamily protein chr3:8287969-8288388 FORWARD LENGTH=139 | 2.0e-15 | 84% |
| RefSeq | Arabidopsis thaliana | NP_188963.2 | ethylene-responsive transcription factor ERF095 [Arabidopsis thaliana] | 3.0e-15 | 84% |
| RefSeq | Populus trichocarpa | XP_002331967.1 | AP2/ERF domain-containing transcription factor [Populus trichocarpa] | 3.0e-17 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQI3
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 96 aas, your sequence is shorter than subject: 79 - 350
Fln protein:
S
Protein Length:
80
Fln nts:
C
Fln Alignment:
GG46A6U01C7GO5___KNYRGVRRRPWGKFAAEIRDSSRQGARLWLGTFNT
C0PQI3_______________RHYRGVRQRPWGKFAAEIRDSSRQGARVWLGTFTT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
