UniGene Name: sp_v3.0_unigene68577
Length: 142 nt
![]() |
---|
>sp_v3.0_unigene68577
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative ABC transporter [Arabidopsis thaliana] | - | - | 2.0e-10 | 81% |
FL-Next | sp=ABC transporter G family member 39; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 81% |
Sma3 | ATP-binding cassette transporter, putative | - | - | 1.966e-30 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 9.24e-26 | - |
Sma3 | Polyamine-transporting ATPase. | EC:3.6.3.31 | - | 3.505e-06 | - |
Source | Gene names |
---|---|
Sma3 | ABC; At1g15520; At1g66950; At2g36380; At3g53480; F1O11.1; F1O19.3; F4P12.180; GSVIVT00019708001; GSVIVT00021655001; GSVIVT00022041001; GSVIVT00022062001; GSVIVT00022064001; GSVIVT00022065001; GSVIVT00022529001; GSVIVT00032575001; GSVIVT00034307001; GSVIVT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | response to ozone | GO:0010193 | Biological Process | 0.0 | - |
Sma3 | lead ion transport | GO:0015692 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosomal protein L11 | IPR000911 | - | 0.0 | - |
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G66950.1 | PDR11, ATPDR11 pleiotropic drug resistance 11 chr1:24978239-24984461 FORWARD LENGTH=1454 | 1.0e-14 | 81% |
RefSeq | Arabidopsis thaliana | NP_176867.2 | ABC transporter G family member 39 [Arabidopsis thaliana] | 1.0e-14 | 81% |
RefSeq | Populus trichocarpa | XP_002311035.1 | predicted protein [Populus trichocarpa] | 4.0e-15 | 84% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q7PC84
Fln msg: Distance to subject end: 884 aas, your sequence is shorter than subject: 47 - 1454
Fln protein:
R
Protein Length:
48
Fln nts:
C
Fln Alignment:
GG46A6U01DA12K___FAREWLLMKRNSFVYIFKTTQISIMAFITMTVFLRTEM
Q7PC84_______________FDREWLLMKRNSFVYVFKTVQITIMSLITMTVYLRTEM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain