|
||||||
|
UniGene Name: sp_v3.0_unigene68433
Length: 204 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene68433
C |
|
Ace file of the UniGene sp_v3.0_unigene68433
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cyclin-dependent kinase 1 [Dunaliella tertiolecta] | - | - | 2.0e-11 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
| Sma3 | Cyclin-dependent kinase | - | - | 1.628e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cyclin-dependent kinase. | EC:2.7.11.22 | - | 7.944e-10 | - |
| Sma3 | [RNA-polymerase]-subunit kinase. | EC:2.7.11.23 | - | 5.8e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | 13; At1g20930; CDC2D; CDKA2; CDKB; CDKB1; CDKB1-1; CDKB2-1; CDKB2-2; CHLREDRAFT_59842; CdkB1; DUNCDC2; F9H16.8; GSVIVT00002946001; LOC_Os01g67160; LOC_Os08g40170; MICPUN_105013; Os01g0897000; Os08g0512600; OsI_04781; OsI_29856; OsI_29864; OsJ_004305; OsJ_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | spindle | GO:0005819 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | cyclin-dependent protein kinase activity | GO:0004693 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | RNA polymerase II carboxy-terminal domain kinase activity | GO:0008353 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | mitosis | GO:0007067 | Biological Process | 0.0 | - |
| Sma3 | hormone-mediated signaling pathway | GO:0009755 | Biological Process | 0.0 | - |
| Sma3 | regulation of meristem structural organization | GO:0009934 | Biological Process | 0.0 | - |
| Sma3 | regulation of G2/M transition of mitotic cell cycle | GO:0010389 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G20930.1 | " CDKB2;2 cyclin-dependent kinase B2;2 chr1:7292752-7294664 REVERSE LENGTH=315" | 5.0e-16 | 80% |
| RefSeq | Arabidopsis thaliana | NP_173517.1 | cyclin-dependent kinase B2-2 [Arabidopsis thaliana] | 6.0e-16 | 80% |
| RefSeq | Populus trichocarpa | XP_002336374.1 | predicted protein [Populus trichocarpa] | 6.0e-14 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAZ1
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 56 aas, your sequence is shorter than subject: 67 - 302
Fln protein:
S
Protein Length:
68
Fln nts:
C
Fln Alignment:
GG46A6U01BPMBD___LFTGDSEVQQLMNIFRFLGTPNEEVWPGVTKLKDWH
D5AAZ1_______________LFTGDSEVQQLMSIFKFLGTPNEEVWPGVTKLKDWH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
