UniGene Name: sp_v3.0_unigene67508
Length: 245 nt
UniGene Fasta |
---|
>sp_v3.0_unigene67508
C |
Ace file of the UniGene sp_v3.0_unigene67508 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cinnamic acid 4-hydroxylase n=1 Tax=Ginkgo biloba RepID=Q3L2Q3_GINBI | - | - | 6.0e-14 | 86% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
Sma3 | Cinnamic acid 4-hydroxylase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Trans-cinnamate 4-monooxygenase. | EC:1.14.13.11 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylalanine metabolism | 00360 | 0.0 | % | |
Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
Sma3 | Flavonoid biosynthesis | 00941 | 0.0 | % | |
Sma3 | Stilbenoid, diarylheptanoid and gingerol biosynthesis | 00945 | 0.0 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | BcCyp450; C4H; C4H-1; C4H-2; C4H1; C4H1-1; C4H1-2; C4H2; C4H2-1; C4H2-2; C4H2|CYP73A42; CYP73; CYP73A1; CYP73A10; CYP73A11; CYP73A12; CYP73A13; CYP73A14; CYP73A16; CYP73A19; CYP73A2; CYP73A3; CYP73A4; CYP73A43|C4H1; CYP73A5; CYP73A9; Ca4h; GSVIVT000239320 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | trans-cinnamate 4-monooxygenase activity | GO:0016710 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G30490.1 | ATC4H, C4H, CYP73A5, REF3 cinnamate-4-hydroxylase chr2:12993861-12995683 REVERSE LENGTH=505 | 1.0e-15 | 77% |
RefSeq | Arabidopsis thaliana | NP_180607.1 | trans-cinnamate 4-monooxygenase [Arabidopsis thaliana] | 2.0e-15 | 77% |
RefSeq | Populus trichocarpa | XP_002319975.1 | cytochrome P450 cinnamate 4-hydroxylase [Populus trichocarpa] | 3.0e-17 | 79% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PRB9
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 409 aas, your sequence is shorter than subject: 81 - 506
Fln protein:
S
Protein Length:
82
Fln nts:
C
Fln Alignment:
GG46A6U01ETLY8___NWLQVGDDLNQRNLTDLAKKYGEIFLLKMGQRNLLVVASPVAGK
C0PRB9_______________NWLQVGDDLNHRNLGDLAKKYGEIFLLKMGQRNLVVVSSPELAK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain