|
||||||
|
UniGene Name: sp_v3.0_unigene67395
Length: 217 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene67395
C |
|
Ace file of the UniGene sp_v3.0_unigene67395
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | oligopeptide transporter 5 [Arabidopsis thaliana] sp|Q9SUA4.1|OPT5_ARATH RecName: Full=Oligopeptide transporter 5; Short=AtOPT5 gb|AAK26002.1|AF360292_1 putative isp4 protein [Arabidopsis thaliana] emb|CAB43855.1| isp4 like protein [Arabidopsis thaliana] | - | - | 2.0e-19 | 68% |
| FL-Next | sp=Oligopeptide transporter 5; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 68% |
| Sma3 | Oligopeptide transporter OPT family | - | - | 3.166e-25 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g09930; At4g10770; At4g26590; At4g27730; At5g53510; At5g53520; At5g55930; At5g64410; B1053A04.20-1; B1053A04.20-2; GSVIVT00000539001; GSVIVT00005733001; GSVIVT00012078001; GSVIVT00015059001; GSVIVT00015061001; GSVIVT00015062001; GSVIVT00033409001; GSVI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | S-adenosylmethionine-dependent methyltransferase activity | GO:0008757 | Molecular Function | 0.0 | - |
| Sma3 | oligopeptide transporter activity | GO:0015198 | Molecular Function | 0.0 | - |
| Sma3 | rRNA processing | GO:0006364 | Biological Process | 0.0 | - |
| Sma3 | oligopeptide transport | GO:0006857 | Biological Process | 0.0 | - |
| Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Bacterial Fmu (Sun)/eukaryotic nucleolar NOL1/Nop2p | IPR001678 | - | 0.0 | - |
| Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
| Sma3 | Tetrapeptide transporter, OPT1/isp4 | IPR004648 | - | 0.0 | - |
| Sma3 | Oligopeptide transporter OPT superfamily | IPR004813 | - | 0.0 | - |
| Sma3 | Nop2p | IPR011023 | - | 0.0 | - |
| Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
| Sma3 | Deoxyribonuclease, TatD-related, conserved site | IPR018228 | - | 0.0 | - |
| Sma3 | Bacterial Fmu (Sun)/eukaryotic nucleolar NOL1/Nop2p, conserved site | IPR018314 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G26590.1 | ATOPT5, OPT5 oligopeptide transporter 5 chr4:13414134-13416850 REVERSE LENGTH=753 | 1.0e-24 | 68% |
| RefSeq | Arabidopsis thaliana | NP_194389.1 | oligopeptide transporter 5 [Arabidopsis thaliana] | 1.0e-24 | 68% |
| RefSeq | Populus trichocarpa | XP_002298879.1 | oligopeptide transporter OPT family [Populus trichocarpa] | 2.0e-24 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SUA4
Fln msg: Distance to subject end: 573 aas, your sequence is shorter than subject: 72 - 753
Fln protein:
V
Protein Length:
73
Fln nts:
C
Fln Alignment:
GG46A6U01CEJGJ___TLNPGPFNMKEHVLITIFASAGSSGVYAVNIVTIVKGFYKRSINPLAAWLLIVSTQMLGFGWA
Q9SUA4_______________SLNPGPFNMKEHVLITIFANTGAGGAYATSILTIVKAFYHRNLNPAAAMLLVQTTQLLGYGWA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
