UniGene Name: sp_v3.0_unigene66976
Length: 245 nt
UniGene Fasta |
---|
>sp_v3.0_unigene66976
C |
Ace file of the UniGene sp_v3.0_unigene66976 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA polymerase n=1 Tax=Populus trichocarpa RepID=B9MYH6_POPTR | - | - | 9.0e-29 | 77% |
FL-Next | sp=DNA polymerase; subsp. trichocarpa). | - | - | 0.0 | 77% |
Sma3 | DNA polymerase | - | - | 2.672e-35 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-directed DNA polymerase. | EC:2.7.7.7 | - | 2.834e-36 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 2.834e-36 | % | |
Sma3 | Pyrimidine metabolism | 00240 | 2.834e-36 | % | |
Sma3 | Metabolic pathways | 01100 | 2.834e-36 | % |
Source | Gene names |
---|---|
Sma3 | At1g08260; At2g27120; GSVIVT00022048001; MICPUCDRAFT_51203; MICPUN_63095; OSJNBa0001A11.28; OSTLU_150; Os02g0511900; OsI_07377; OsJ_06880; Ot11g02010; PHATRDRAFT_52678; PHYPADRAFT_136896; POPTRDRAFT_594813; RCOM_0792580; THAPSDRAFT_268553; VITISV_040148; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | epsilon DNA polymerase complex | GO:0008622 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | DNA-directed DNA polymerase activity | GO:0003887 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | DNA replication | GO:0006260 | Biological Process | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | positive regulation of S phase of mitotic cell cycle | GO:0045750 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | RNA polymerase sigma-70 factor | IPR000943 | - | 0.0 | - |
Sma3 | Aminotransferase, class-II, pyridoxal-phosphate binding site | IPR001917 | - | 0.0 | - |
Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
Sma3 | DNA-directed DNA polymerase, family B, exonuclease domain | IPR006133 | - | 0.0 | - |
Sma3 | DNA-directed DNA polymerase, family B, multifunctional domain | IPR006134 | - | 0.0 | - |
Sma3 | DNA-directed DNA polymerase, family B | IPR006172 | - | 0.0 | - |
Sma3 | DNA polymerase epsilon, catalytic subunit A, C-terminal | IPR013697 | - | 0.0 | - |
Sma3 | IPR015706 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G08260.1 | EMB142, EMB2284, POL2A, TIL1, EMB529, ABO4, ESD7 DNA polymerase epsilon catalytic subunit chr1:2590944-2606892 FORWARD LENGTH=2161 | 2.0e-34 | 74% |
RefSeq | Arabidopsis thaliana | NP_172303.5 | DNA polymerase epsilon subunit 1 [Arabidopsis thaliana] | 3.0e-34 | 74% |
RefSeq | Populus trichocarpa | XP_002328167.1 | predicted protein [Populus trichocarpa] | 3.0e-35 | 77% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: B9MYH6
Fln msg: Distance to subject end: 1638 aas, your sequence is shorter than subject: 81 - 2221
Fln protein:
K
Protein Length:
82
Fln nts:
C
Fln Alignment:
GG46A6U01B5SII___KGHLLESETYIGGHVECLESGVFRSDLPTKFRLDPLAYQQLIDNLDRDLQYAIKVEGKMDLDSVINYEEVKNDIKRQLESL
B9MYH6_______________KSHLLESETYIGGHVECLESGVFRSDLPTSFKLDPSAYELLIKNLDRDLQYAIRVEGKMDLDLISNYDEVKNVIMEKLVCL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain