|
||||||
|
UniGene Name: sp_v3.0_unigene65906
Length: 237 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene65906
A |
|
Ace file of the UniGene sp_v3.0_unigene65906
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Thaumatin-like protein n=3 Tax=Arabidopsis RepID=TLPH_ARATH | - | - | 4.0e-21 | 64% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
| Sma3 | Thaumatin-like protein | - | - | 7.506e-18 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g18250; At1g19320; At1g73620; At1g73620/F25P22_3; At5g02140; BFTP; CETLP; Cry j 3.5; F25P22.3; GSVIVT00014680001; GSVIVT00019212001; GSVIVT00021354001; GSVIVT00026571001; LOC_Os03g14050; Os03g0244200; Os06g0691200; OsI_10722; OsI_24266; OsI_37712; OsJ_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Inositol monophosphatase | IPR000760 | - | 0.0 | - |
| Sma3 | Blue (type 1) copper domain | IPR000923 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Thaumatin, pathogenesis-related | IPR001938 | - | 0.0 | - |
| Sma3 | GNS1/SUR4 membrane protein | IPR002076 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I2, Kunitz metazoa | IPR002223 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | 3(2),5 -bisphosphate nucleotidase HAL2 | IPR006239 | - | 0.0 | - |
| Sma3 | Thaumatin, conserved site | IPR017949 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G18250.2 | - | 2.0e-28 | 64% |
| RefSeq | Arabidopsis thaliana | NP_173261.1 | Thaumatin-like protein [Arabidopsis thaliana] | 3.0e-28 | 64% |
| RefSeq | Populus trichocarpa | XP_002322099.1 | predicted protein [Populus trichocarpa] | 2.0e-26 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NYU8
Fln msg: Distance to subject end: 31 aas, your sequence is shorter than subject: 78 - 243
Fln protein:
A
Protein Length:
79
Fln nts:
A
Fln Alignment:
GFXCM5X02GDN8B___RGGGTCVRLVGCLADLNERCPAALQVKWKGG-VVACKSACSAFNSPQYCCTGSYGNPQTCKPTGYSRLFK
A9NYU8_______________RGSGKCT-YAGCISDLNLSCPPSLQVKNEQGCVMACKSACFAFSTPQYCCTGSYGNPQTCRPTSFSRLFK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
