UniGene Name: sp_v3.0_unigene65332
Length: 187 nt
![]() |
---|
>sp_v3.0_unigene65332
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | translation elongation factor-1 alpha [Picea abies] | - | - | 1.0e-17 | 94% |
FL-Next | sp=Elongation factor 1-alpha; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
Sma3 | Elongation factor 1-alpha | - | - | 2.002e-21 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Sulfate adenylyltransferase. | EC:2.7.7.4 | - | 5.894e-06 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 5.894e-06 | % | |
Sma3 | Selenocompound metabolism | 00450 | 5.894e-06 | % | |
Sma3 | Sulfur metabolism | 00920 | 5.894e-06 | % | |
Sma3 | Metabolic pathways | 01100 | 5.894e-06 | % |
Source | Gene names |
---|---|
Sma3 | A1; A2; A3; A4; AT1G07930; AT1G07940; AcoEF1a; At1g07920; At1g07920/T6D22.2; At1g07930; At1g07940; At5g60390; BLT63; EF-1-alpha; EF-1-alpha1; EF-1alpha; EF1; EF1-A; EF1-a; EF1-a1; EF1-alpha; EF1A; EF1A1; EF1A2; EF1A3; EF1A4; EF1A5; EF1A6; EF1A7; EF1A8; EF |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | translation elongation factor activity | GO:0003746 | Molecular Function | 0.0 | - |
Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | translational elongation | GO:0006414 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein synthesis factor, GTP-binding | IPR000795 | - | 0.0 | - |
Sma3 | Translation elongation factor EFTu/EF1A, C-terminal | IPR004160 | - | 0.0 | - |
Sma3 | Translation elongation factor EFTu/EF1A, domain 2 | IPR004161 | - | 0.0 | - |
Sma3 | Translation elongation factor EF1A, eukaryotic/archaeal | IPR004539 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G60390.1 | GTP binding Elongation factor Tu family protein chr5:24289226-24290675 FORWARD LENGTH=449 | 1.0e-16 | 84% |
RefSeq | Arabidopsis thaliana | NP_001030993.1 | Elongation factor 1-alpha [Arabidopsis thaliana] | 1.0e-16 | 84% |
RefSeq | Populus trichocarpa | XP_002326338.1 | predicted protein [Populus trichocarpa] | 1.0e-19 | 92% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PTP0
Fln msg: Overlapping hits, possible frame ERROR between 55 and 54, Distance to subject end: 37 aas, your sequence is shorter than subject: 62 - 447
Fln protein:
D
Protein Length:
63
Fln nts:
G
Fln Alignment:
G5KS2UX02GWGY2___DCHTCHIAVKFFAEIMTxVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVRNF
C0PTP0_______________DCHTCHIAVK-FSEIMTxVDRRSGKELEKEPKFLKNGDAGFVKMIPTKPMVVETF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain