UniGene Name: sp_v3.0_unigene65296
Length: 190 nt
UniGene Fasta |
---|
>sp_v3.0_unigene65296
A |
Ace file of the UniGene sp_v3.0_unigene65296 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Xyloglucan endotransglucosylase/hydrolase n=1 Tax=Dianthus caryophyllus RepID=D7URZ1_DIACA | - | - | 5.0e-22 | 71% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 60% |
Sma3 | Xyloglucan endotransglycosylase | - | - | 1.366e-31 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Xyloglucan:xyloglucosyl transferase. | EC:2.4.1.207 | - | 2.12997e-43 | - |
Source | Gene names |
---|---|
Sma3 | 19-1-5; AT2G06850; AoXET1; AoXET2; At1g65310; At2g06850; At3g23730; At4g14130; At4g37800; At5g13870; At5g65730; EXGT-A1; EXGT-A4; EXT; FCAALL.173; GSVIVT00003361001; GSVIVT00003461001; GSVIVT00003480001; GSVIVT00006236001; GSVIVT00007248001; GSVIVT0003140 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | xyloglucan:xyloglucosyl transferase activity | GO:0016762 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | cellular glucan metabolic process | GO:0006073 | Biological Process | 0.0 | - |
Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
Sma3 | response to mechanical stimulus | GO:0009612 | Biological Process | 0.0 | - |
Sma3 | response to low light intensity stimulus | GO:0009645 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycoside hydrolase, family 16 | IPR000757 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 16, active site | IPR008263 | - | 0.0 | - |
Sma3 | Beta-glucanase | IPR008264 | - | 0.0 | - |
Sma3 | Xyloglucan endo-transglycosylase, C-terminal | IPR010713 | - | 0.0 | - |
Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
Sma3 | Xyloglucan endotransglucosylase/hydrolase | IPR016455 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, conserved site | IPR018522 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G65730.1 | XTH6 xyloglucan endotransglucosylase/hydrolase 6 chr5:26299080-26300290 FORWARD LENGTH=292 | 3.0e-24 | 61% |
RefSeq | Arabidopsis thaliana | NP_569019.1 | xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana] | 3.0e-24 | 61% |
RefSeq | Populus trichocarpa | XP_002310324.1 | predicted protein [Populus trichocarpa] | 1.0e-26 | 66% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NNK0
Fln msg: Distance to subject end: 60 aas, your sequence is shorter than subject: 62 - 275
Fln protein:
C
Protein Length:
63
Fln nts:
A
Fln Alignment:
G5KS2UX02G4U12___HILFSVDEIPIRVYKNDKARGLPFPRNQMMGIFCTLWQADNWATRGGIEKIDWRKAPFVAA
A9NNK0_______________YILFMVDEVPIRVFMNNKALGVPYPERQAMGVFSSIWNGDSWATQGGLVKIDWSHAPFVAA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain