UniGene Name: sp_v3.0_unigene65295
Length: 195 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene65295
A |
Ace file of the UniGene sp_v3.0_unigene65295
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative protein kinase [Arabidopsis thaliana] | - | - | 1.0e-24 | 86% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
| Sma3 | Cdk10/11, putative | - | - | 3.722e-12 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cyclin-dependent kinase. | EC:2.7.11.22 | - | 1.398e-07 | - |
| Sma3 | [RNA-polymerase]-subunit kinase. | EC:2.7.11.23 | - | 3.426e-15 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g67580/F12B7.13; At5g63370; At5g63370/K9H21.7; CD2L1; CDC2C; CDK1; CDKA1; CDKG-1; CDKG-2; CDKH1; CHLREDRAFT_153970; GSVIVT00017899001; GSVIVT00035090001; MICPUCDRAFT_22143; MICPUCDRAFT_27380; MICPUCDRAFT_48067; MICPUN_59202; MICPUN_85942; NtPITSLRE alp |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | cyclin-dependent protein kinase activity | GO:0004693 | Molecular Function | 0.0 | - |
| Sma3 | MAP kinase activity | GO:0004707 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | RNA polymerase II carboxy-terminal domain kinase activity | GO:0008353 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | mitosis | GO:0007067 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | MAP kinase, conserved site | IPR003527 | - | 0.0 | - |
| Sma3 | Remorin, C-terminal | IPR005516 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G67580.1 | Protein kinase superfamily protein chr1:25327727-25330965 REVERSE LENGTH=752 | 4.0e-31 | 86% |
| RefSeq | Arabidopsis thaliana | NP_001154456.1 | protein kinase-like protein [Arabidopsis thaliana] | 5.0e-31 | 86% |
| RefSeq | Populus trichocarpa | XP_002312637.1 | predicted protein [Populus trichocarpa] | 6.0e-32 | 87% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PSZ5
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 179 aas, your sequence is shorter than subject: 64 - 875
Fln protein:
M
Protein Length:
65
Fln nts:
A
Fln Alignment:
G5KS2UX02H5LJN___EGVSYLHDNWVLHRDLKTSNLLLNNKGDLKMCDFGMARQYSSPLKTYTHMVVTLWYR
C0PSZ5_______________EGVKYLHDNWVLHRDLKTSNLLLNNCGELKICDFGLARQYGSPLKPYTQMVVTLWYR

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta