UniGene Name: sp_v3.0_unigene64982
Length: 221 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene64982
T |
Ace file of the UniGene sp_v3.0_unigene64982 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9FI80.1|PP425_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g48910 dbj|BAB10314.1| selenium-binding protein-like [Arabidopsis thaliana] gb|AAL07167.1| putative sel | - | - | 1.0e-17 | 60% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 66% |
Sma3 | Pentatricopeptide, putative, expressed | - | - | 1.579e-08 | - |
Source | Gene names |
---|---|
Sma3 | At1g08070; At1g26900; At1g59720; At1g74630; At2g22070; At3g11460; At3g47530; At3g49170; At4g16835; At4g21300; At5g15300; At5g48910; At5g66520; B1032F05.19; DYW10; EMB2261; F1M20.31; F1P2.80; F23H11.3; F24K9.13; F2K15.30; F8M21_190; FCAALL.441; GSVIVT00001 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G48910.1 | LPA66 Pentatricopeptide repeat (PPR) superfamily protein chr5:19832969-19834909 REVERSE LENGTH=646 | 9.0e-23 | 60% |
RefSeq | Arabidopsis thaliana | NP_199702.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-22 | 60% |
RefSeq | Populus trichocarpa | XP_002308572.1 | predicted protein [Populus trichocarpa] | 1.0e-23 | 62% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ0
Fln msg: Distance to subject end: 60 aas, your sequence is shorter than subject: 73 - 644
Fln protein:
Y
Protein Length:
74
Fln nts:
T
Fln Alignment:
G5KS2UX02HFNFK___YFDRMIQCYHIEPAMEHYGCMVDLLGRAGLLTEAIGFINSMAITPDATVWVSLLGACRVHNNVELGERVAGH
B8LLJ0_______________YFDIMTRFYHITPAMEHYGCMIDLLGRAGCFDEANDLINKMPIKPDADMWGSLLSACRTHNNIDLGEKVAQH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain