UniGene Name: sp_v3.0_unigene64974
Length: 206 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene64974
A |
Ace file of the UniGene sp_v3.0_unigene64974
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Isoleucyl-tRNA synthetase n=1 Tax=Thermosynechococcus elongatus BP-1 RepID=SYI_THEEB | - | - | 1.0e-16 | 100% |
| FL-Next | tr=Predicted protein; subsp. trichocarpa). | - | - | 0.0 | 95% |
| Sma3 | Isoleucyl-tRNA synthetase | - | - | 3.753e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Isoleucine--tRNA ligase. | EC:6.1.1.5 | - | 1.876e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Valine, leucine and isoleucine biosynthesis | 00290 | 1.876e-07 | % | |
| Sma3 | Aminoacyl-tRNA biosynthesis | 00970 | 1.876e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT5G49030; At5g49030; CHLREDRAFT_106327; GSVIVT00019784001; ITS2; MICPUCDRAFT_46060; MICPUN_97914; OJ1534_E09.23; OSTLU_45389; Os02g0778200; OsI_09155; OsJ_08590; Ot04g00470; PHATRDRAFT_17198; PHYPADRAFT_56033; POPTRDRAFT_1089196; RCOM_0681070; THAPSDRAFT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | isoleucine-tRNA ligase activity | GO:0004822 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | isoleucyl-tRNA aminoacylation | GO:0006428 | Biological Process | 0.0 | - |
| Sma3 | ovule development | GO:0048481 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
| Sma3 | Aminoacyl-tRNA synthetase, class Ia | IPR002300 | - | 0.0 | - |
| Sma3 | Isoleucyl-tRNA synthetase | IPR002301 | - | 0.0 | - |
| Sma3 | Zinc finger, DNA glycosylase/AP lyase/isoleucyl tRNA synthetase | IPR010663 | - | 0.0 | - |
| Sma3 | Valyl/Leucyl/Isoleucyl-tRNA synthetase, class I, anticodon-binding | IPR013155 | - | 0.0 | - |
| Sma3 | Rossmann-like alpha/beta/alpha sandwich fold | IPR014729 | - | 0.0 | - |
| Sma3 | IPR015905 | - | 0.0 | - | |
| Sma3 | IPR018353 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G49030.1 | OVA2 tRNA synthetase class I (I, L, M and V) family protein chr5:19875091-19882291 REVERSE LENGTH=1093 | 3.0e-16 | 100% |
| RefSeq | Arabidopsis thaliana | NP_001190497.1 | isoleucyl-tRNA synthetase [Arabidopsis thaliana] | 4.0e-16 | 100% |
| RefSeq | Populus trichocarpa | XP_002314391.1 | predicted protein [Populus trichocarpa] | 3.0e-18 | 95% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: B9HXV6
Fln msg: Separated hits, possible frame ERROR between 73 and 81, and overlapping frame ERROR between 179 and 175, Unexpected stop codon in the beginning of your sequence, Distance to subject end: 503 aas, your sequence is shorter than subject: 69 - 981
Fln protein:
M
Protein Length:
70
Fln nts:
A
Fln Alignment:
G5KS2UX02G7RI5___HKYPYDWRTKKPTIFRATEQWFxxxVEVFRQAVLHAIKEVKWIPSQGENRITSMIDxxSDWCISRQ
B9HXV6_______________HNYPYDWRTKKPTIFRATEQWFxxxVEGFRQSAMEAISQVKWIPPQGENRITAMTSxxSDWCISRQ

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta