UniGene Name: sp_v3.0_unigene64665
Length: 188 nt
![]() |
---|
>sp_v3.0_unigene64665
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Shk1 kinase-binding protein, putative n=1 Tax=Ricinus communis RepID=B9SPU1_RICCO | - | - | 3.0e-21 | 80% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
Sma3 | Protein arginine N-methyltransferase | - | - | 1.918e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Transferring one-carbon groups, Methyltransferases. | EC:2.1.1.- | - | 3.632e-06 | - |
Source | Gene names |
---|---|
Sma3 | At4g31120; CHLREDRAFT_114319; F6E21.40; GSVIVT00032396001; OsI_005646; OsI_05787; OsJ_05316; PHYPADRAFT_198088; PHYPADRAFT_218804; PMRT5; POPTRDRAFT_835729; PRMT1504; PRMT1506; PRMT5; RCOM_0205920; SKB1; VITISV_030976; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | histone-arginine N-methyltransferase activity | GO:0008469 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | regulation of flower development | GO:0009909 | Biological Process | 0.0 | - |
Sma3 | positive regulation of vernalization response | GO:0010220 | Biological Process | 0.0 | - |
Sma3 | chromatin modification | GO:0016568 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Skb1 methyltransferase | IPR007857 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G31120.1 | SKB1, ATPRMT5 SHK1 binding protein 1 chr4:15132185-15136568 REVERSE LENGTH=642 | 2.0e-27 | 83% |
RefSeq | Arabidopsis thaliana | NP_974647.1 | protein arginine N-methyltransferase 5 [Arabidopsis thaliana] | 2.0e-27 | 83% |
RefSeq | Populus trichocarpa | XP_002324705.1 | predicted protein [Populus trichocarpa] | 5.0e-26 | 78% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A8K7
Fln msg: Distance to subject end: 112 aas, your sequence is shorter than subject: 62 - 216
Fln protein:
C
Protein Length:
63
Fln nts:
A
Fln Alignment:
G5KS2UX02IPHUZ___IPSSYTSFVVNLITASKLYNDVKSHKDIAHFETAYVVKLHSIARLAPTQPVFTFTHPNFSP
D5A8K7_______________IPSSYTSFI-EPITASKLHNDVKSHKDIAHFETAYVVKLHSIARLAPPQPVFTFTHPNFSP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain