UniGene Name: sp_v3.0_unigene64593
Length: 175 nt
UniGene Fasta |
---|
>sp_v3.0_unigene64593
A |
Ace file of the UniGene sp_v3.0_unigene64593 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
Sma3 | Putative pentatricopeptide (PPR) repeat-containing protein | - | - | 4.032e-14 | - |
Source | Gene names |
---|---|
Sma3 | At1g28690; At1g59720; At2g01510; At2g13600; At2g22070; At2g33760; At2g40720; At3g46790; At4g02750; At4g16835; At5g40410; B1032F05.19; B1045D11.23; CRR2; DYW10; F1K23.11; F23H11.3; F2I9.13; FCAALL.441; GSVIVT00000887001; GSVIVT00001532001; GSVIVT0000170600 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | protein transporter activity | GO:0008565 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
Sma3 | RNA metabolic process | GO:0016070 | Biological Process | 0.0 | - |
Sma3 | mRNA modification | GO:0016556 | Biological Process | 0.0 | - |
Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
Sma3 | methylation | GO:0032259 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G02750.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:1221116-1223461 REVERSE LENGTH=781 | 6.0e-20 | 65% |
RefSeq | Arabidopsis thaliana | NP_192184.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 7.0e-20 | 65% |
RefSeq | Populus trichocarpa | XP_002309169.1 | predicted protein [Populus trichocarpa] | 6.0e-21 | 67% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: Distance to subject end: 44 aas, your sequence is shorter than subject: 57 - 232
Fln protein:
C
Protein Length:
58
Fln nts:
A
Fln Alignment:
G5KS2UX02GJN41___VTFISVLSACSHAGLVNEGRQYFDCMSQDYCITPRMEHYVCMVDLLGRAGFLNEAH
D5AB53_______________VTFVGVLSACCHAGLVSEGRQYFNSMSVDYHITPVMEHYCCMVDLLGRTGCLDEAH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain