|
||||||
|
UniGene Name: sp_v3.0_unigene64555
Length: 235 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene64555
A |
|
Ace file of the UniGene sp_v3.0_unigene64555
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Arf6/ArfB-family small GTPase n=3 Tax=Physcomitrella patens subsp. patens RepID=A9RZH0_PHYPA | - | - | 1.0e-10 | 91% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
| Sma3 | ADP-ribosylation factor | - | - | 3.973e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | ArfB21; ArfB22; ArfB23; At3g03120; At5g17060; CGL49; CHLREDRAFT_78189; F2K13_210; LOC_Os10g42940; MICPUCDRAFT_30191; MICPUN_94315; OSJNBa0056G17.9; OSTLU_37806; Os02g0128600; Os02g0699300; Os10g0580200; OsI_05700; OsI_08579; OsI_21370; OsJ_05228; OsJ_0803 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | phosphatidylinositol 3-kinase complex | GO:0005942 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | 1-phosphatidylinositol-3-kinase activity | GO:0016303 | Molecular Function | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | small GTPase mediated signal transduction | GO:0007264 | Biological Process | 0.0 | - |
| Sma3 | phosphatidylinositol phosphorylation | GO:0046854 | Biological Process | 0.0 | - |
| Sma3 | phosphatidylinositol-mediated signaling | GO:0048015 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphatidylinositol 3-/4-kinase, catalytic domain | IPR000403 | - | 0.0 | - |
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Phosphoinositide 3-kinase, accessory (PIK) domain | IPR001263 | - | 0.0 | - |
| Sma3 | Phosphoinositide 3-kinase, C2 | IPR002420 | - | 0.0 | - |
| Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
| Sma3 | Small GTP-binding protein domain | IPR005225 | - | 0.0 | - |
| Sma3 | IPR006688 | - | 0.0 | - | |
| Sma3 | Small GTPase superfamily, ARF/SAR type | IPR006689 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol Kinase | IPR015433 | - | 0.0 | - |
| Sma3 | Phosphatidylinositol 3/4-kinase, conserved site | IPR018936 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G17060.1 | ATARFB1B, ARFB1B ADP-ribosylation factor B1B chr5:5611056-5612639 FORWARD LENGTH=192 | 3.0e-15 | 88% |
| RefSeq | Arabidopsis thaliana | NP_197208.1 | ADP-ribosylation factor B1B [Arabidopsis thaliana] | 3.0e-15 | 88% |
| RefSeq | Populus trichocarpa | XP_002319891.1 | predicted protein [Populus trichocarpa] | 6.0e-15 | 88% |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NNN8
Fln msg: Distance to subject end: 159 aas, your sequence is shorter than subject: 36 - 195
Fln protein:
M
Protein Length:
37
Fln nts:
A
Fln Alignment:
G5KS2UX02G8XUW___MGQVFRKLFDNIFGNKEMRVVMLGLDAAGKTTILYK
A9NNN8_______________MGQTFRKLFDNIFGNKEMRVVMLGLDAAGKTTILYK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
