|
||||||
|
UniGene Name: sp_v3.0_unigene64536
Length: 238 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene64536
G |
|
Ace file of the UniGene sp_v3.0_unigene64536
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cytochrome P450 86A2 [Arabidopsis thaliana] sp|O23066.1|C86A2_ARATH RecName: Full=Cytochrome P450 86A2 gb|AAF02801.1|AF195115_21 belongs to the cytochrome p450 family [Arabidopsis thaliana] gb|AAB62843.1| belongs to the cytochrome p450 family [Arabidopsis | - | - | 2.0e-21 | 67% |
| FL-Next | sp=Cytochrome P450 86A2; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 67% |
| Sma3 | Cytochrome P450 | - | - | 4.512e-06 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Unspecific monooxygenase. | EC:1.14.14.1 | - | 5.012e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fatty acid metabolism | 00071 | 5.012e-08 | % | |
| Sma3 | Steroid hormone biosynthesis | 00140 | 5.012e-08 | % | |
| Sma3 | Caffeine metabolism | 00232 | 5.012e-08 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 5.012e-08 | % | |
| Sma3 | Arachidonic acid metabolism | 00590 | 5.012e-08 | % | |
| Sma3 | Linoleic acid metabolism | 00591 | 5.012e-08 | % | |
| Sma3 | Aminobenzoate degradation | 00627 | 5.012e-08 | % | |
| Sma3 | Retinol metabolism | 00830 | 5.012e-08 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 5.012e-08 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 5.012e-08 | % | |
| Sma3 | Drug metabolism - other enzymes | 00983 | 5.012e-08 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 5.012e-08 | % | |
| Sma3 | Metabolic pathways | 01100 | 5.012e-08 | % |
| Source | Gene names |
|---|---|
| Sma3 | A_IG005I10.21; At1g01600; At1g01600/F22L4_10; At1g63710; At2g45970; At4g00360; At5g58860; CYP86; CYP86A1; CYP86A19; CYP86A2; CYP86A20; CYP86A21; CYP86A22; CYP86A24; F22L4.14; F24D7.10; F5I10.21; GSVIVT00000440001; GSVIVT00024147001; GSVIVT00026885001; K19 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | GO:0008393 | Molecular Function | 0.0 | - | |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | fatty acid metabolic process | GO:0006631 | Biological Process | 0.0 | - |
| Sma3 | suberin biosynthetic process | GO:0010345 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G00360.1 | CYP86A2, ATT1 cytochrome P450, family 86, subfamily A, polypeptide 2 chr4:160951-162778 FORWARD LENGTH=553 | 8.0e-27 | 67% |
| RefSeq | Arabidopsis thaliana | NP_191946.1 | cytochrome P450 86A2 [Arabidopsis thaliana] | 1.0e-26 | 67% |
| RefSeq | Populus trichocarpa | XP_002320802.1 | cytochrome P450 [Populus trichocarpa] | 2.0e-23 | 60% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O23066
Fln msg: Distance to subject end: 451 aas, your sequence is shorter than subject: 79 - 553
Fln protein:
L
Protein Length:
80
Fln nts:
G
Fln Alignment:
G5KS2UX02I8GYY___LKGPKVWPVVGSLPELM-QNSHMHDWFTEYLQKTGGTYQTCTCAIPFLARKQGLVTITSNVKNIEHFM
O23066_______________LKGPRVWPVLGSLPGLIEQRDRMHDWITENLRACGGTYQTCICAVPFLAKKQGLVTVTCDPKNIEHML
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
