|
||||||
|
UniGene Name: sp_v3.0_unigene64278
Length: 181 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene64278
A |
|
Ace file of the UniGene sp_v3.0_unigene64278
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Protein phosphatase 2c, putative n=1 Tax=Ricinus communis RepID=B9SXJ0_RICCO | - | - | 4.0e-22 | 87% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
| Sma3 | Protein phosphatase 2c, putative | - | - | 2.19e-15 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphoprotein phosphatase. | EC:3.1.3.16 | - | 3.69943e-42 | - |
| Source | Gene names |
|---|---|
| Sma3 | At3g12620; At3g17090; At3g51370; At3g55050; At4g33920; At4g38520; At5g02760; At5g06750; At5g66080; BIPP2C2; F17I5.110; F20M13.80; F26O13.10; F9G14.70; GSVIVT00001432001; GSVIVT00014932001; GSVIVT00019625001; GSVIVT00023088001; GSVIVT00025384001; GSVIVT000 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine phosphatase complex | GO:0008287 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | phosphoprotein phosphatase activity | GO:0004721 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine phosphatase activity | GO:0004722 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | protein dephosphorylation | GO:0006470 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein phosphatase 2C, manganese/magnesium aspartate binding site | IPR000222 | - | 0.0 | - |
| Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
| Sma3 | Protein phosphatase 2C-like | IPR001932 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
| Sma3 | IPR014045 | - | 0.0 | - | |
| Sma3 | Protein phosphatase 2C | IPR015655 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G06750.1 | Protein phosphatase 2C family protein chr5:2086403-2088245 REVERSE LENGTH=393 | 5.0e-28 | 84% |
| RefSeq | Arabidopsis thaliana | NP_001119180.1 | putative protein phosphatase 2C 68 [Arabidopsis thaliana] | 5.0e-28 | 84% |
| RefSeq | Populus trichocarpa | XP_002309303.1 | predicted protein [Populus trichocarpa] | 7.0e-29 | 86% |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LQT5
Fln msg: Distance to subject end: 156 aas, your sequence is shorter than subject: 60 - 209
Fln protein:
M
Protein Length:
61
Fln nts:
A
Fln Alignment:
G5KS2UX02HBXUZ___QLTKDHNASEEEVRQELKALHPDDSQIVVLKHGVWRVKGIIQVSRSIGDVYL
B8LQT5_______________QLSTEHNAGIEAVRQELQSLHPDDPRIVVLKHGVWRVKGIIQVSRSIGDVYL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
