UniGene Name: sp_v3.0_unigene64227
Length: 216 nt
![]() |
---|
>sp_v3.0_unigene64227
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Peroxidase 53 n=4 Tax=Brassicaceae RepID=PER53_ARATH | - | - | 3.0e-21 | 66% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
Sma3 | Peroxidase | - | - | 1.356e-35 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peroxidase. | EC:1.11.1.7 | - | 9.164e-37 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylalanine metabolism | 00360 | 9.164e-37 | % | |
Sma3 | Methane metabolism | 00680 | 9.164e-37 | % | |
Sma3 | Phenylpropanoid biosynthesis | 00940 | 9.164e-37 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 9.164e-37 | % | |
Sma3 | Metabolic pathways | 01100 | 9.164e-37 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 9.164e-37 | % |
Source | Gene names |
---|---|
Sma3 | At5g06720; At5g06730; CEVI-1; FBP1; FBP5; FLXPER1; GSVIVT00024722001; GSVIVT00024724001; GSVIVT00025396001; HPOX14; HRPA2; MPH15.8; MPH15.9; P53; P54; PER53; PER54; PO5; PO6; POD1; POPTRDRAFT_277655; POPTRDRAFT_547662; POPTRDRAFT_547665; POPTRDRAFT_555257 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G06720.1 | ATPA2, PA2 peroxidase 2 chr5:2077567-2078857 REVERSE LENGTH=335 | 3.0e-28 | 66% |
RefSeq | Arabidopsis thaliana | NP_196290.1 | peroxidase 53 [Arabidopsis thaliana] | 5.0e-28 | 66% |
RefSeq | Populus trichocarpa | XP_002336172.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-26 | 59% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NN21
Fln msg: Distance to subject end: 67 aas, your sequence is shorter than subject: 72 - 324
Fln protein:
S
Protein Length:
73
Fln nts:
T
Fln Alignment:
G5KS2UX02J0QFQ___SGAHTIGRAHCGAFIYRLNNFNGTGNPDPTLDSSYRSTLQRICLQDGNGSSITSFDPGTPNTFDNNYFANLQ
A9NN21_______________SGAHTIGRARCQTFSSRLYNFSGTAKPDPTLNSCYLSTLQSACPQNGNMSSITSFDPGTPNTFDNNYFINLQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain