|
||||||
|
UniGene Name: sp_v3.0_unigene64115
Length: 190 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene64115
A |
|
Ace file of the UniGene sp_v3.0_unigene64115
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytochrome c oxidase subunit 1 n=1 Tax=Mycosphaerella graminicola RepID=A9Y5H1_MYCGR | - | - | 4.0e-27 | 96% |
| FL-Next | sp=Cytochrome c oxidase subunit 1; Marchantia polymorpha (Liverwort) (Marchantia aquatica). Mitochondrion. | - | - | 0.0 | 83% |
| Sma3 | Cytochrome c oxidase subunit 1 | - | - | 2.619e-28 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome-c oxidase. | EC:1.9.3.1 | - | 3.824e-28 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxidative phosphorylation | 00190 | 3.824e-28 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.824e-28 | % |
| Source | Gene names |
|---|---|
| Sma3 | COI; COX1; COXI; Cox1; OtMtg00240; P0681H07.38; POPTRDRAFT_282779; POPTRDRAFT_788744; PtMtg00400; cox1; coxI; coxI-2; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrial inner membrane | GO:0005743 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | cytochrome-c oxidase activity | GO:0004129 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | copper ion binding | GO:0005507 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | aerobic respiration | GO:0009060 | Biological Process | 0.0 | - |
| Sma3 | electron transport chain | GO:0022900 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome c oxidase, subunit I | IPR000883 | - | 0.0 | - |
| Sma3 | Cytochrome c oxidase, subunit I bacterial type | IPR014241 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | ATMG01360.1 | COX1 cytochrome oxidase chrM:349830-351413 REVERSE LENGTH=527 | 1.0e-29 | 83% |
| RefSeq | Arabidopsis thaliana | NP_085587.1 | cytochrome c oxidase subunit 1 (mitochondrion) [Arabidopsis thaliana] | 2.0e-29 | 83% |
| RefSeq | Populus trichocarpa | XP_002332841.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-30 | 83% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P26856
Fln msg: Distance to subject end: 234 aas, your sequence is shorter than subject: 63 - 522
Fln protein:
A
Protein Length:
64
Fln nts:
A
Fln Alignment:
G5KS2UX02HOZGV___AGGGDPILYQHLF*FFGHPEVYILIIPGFGIISTTISASSNKAVFGYLGMVYAMMSIGVLGF
P26856_______________AGGGDPILYQHLFWFFGHPEVYILILPGFGIISHIVSTFSRKPVFGYLGMVYAMISIGVLGF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
