UniGene Name: sp_v3.0_unigene63881
Length: 175 nt
UniGene Fasta |
---|
>sp_v3.0_unigene63881
A |
Ace file of the UniGene sp_v3.0_unigene63881 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | NIP3 n=2 Tax=Medicago truncatula RepID=Q6QIL3_MEDTR | - | - | 3.0e-12 | 78% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 95% |
Sma3 | Aquaporin, MIP family, NIP subfamily | - | - | 2.662e-14 | - |
Source | Gene names |
---|---|
Sma3 | At1g80760; At4g10380; F23A5.11; F24G24.180; GSVIVT00000446001; GSVIVT00033750001; LOC_Os10g36924; NIP3; NIP3-1; NIP3A; NIP4; NIP5-1; NIP6-1; NLM6; OSJNBa0026L12.23; OSJNBa0026L12.32; Os10g0513200; OsI_34300; OsJ_030877; PHYPADRAFT_147365; POPTRDRAFT_70801 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | transporter activity | GO:0005215 | Molecular Function | 0.0 | - |
Sma3 | arsenite transmembrane transporter activity | GO:0015105 | Molecular Function | 0.0 | - |
Sma3 | glycerol transmembrane transporter activity | GO:0015168 | Molecular Function | 0.0 | - |
Sma3 | urea transmembrane transporter activity | GO:0015204 | Molecular Function | 0.0 | - |
Sma3 | water channel activity | GO:0015250 | Molecular Function | 0.0 | - |
Sma3 | borate transmembrane transporter activity | GO:0046715 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | response to boron-containing substance | GO:0010036 | Biological Process | 0.0 | - |
Sma3 | arsenite transport | GO:0015700 | Biological Process | 0.0 | - |
Sma3 | response to arsenic-containing substance | GO:0046685 | Biological Process | 0.0 | - |
Sma3 | borate transport | GO:0046713 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Major intrinsic protein | IPR000425 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | Aquaporin | IPR012269 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G80760.1 | " NIP6;1, NIP6, NLM7 NOD26-like intrinsic protein 6;1 chr1:30350640-30352015 REVERSE LENGTH=305" | 2.0e-16 | 71% |
RefSeq | Arabidopsis thaliana | NP_178191.1 | aquaporin NIP6-1 [Arabidopsis thaliana] | 3.0e-16 | 71% |
RefSeq | Populus trichocarpa | XP_002317642.1 | aquaporin, MIP family, NIP subfamily [Populus trichocarpa] | 3.0e-17 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AB86
Fln msg: STOP codon was not found. Distance to subject end: 15 aas, your sequence is shorter than subject: 58 - 294
Fln protein:
M
Protein Length:
59
Fln nts:
A
Fln Alignment:
G5KS2UX02JI6Y4___MNPVRTLGPAIAAGNYKGIWIYLLAPVIGALCGAAAYTVVRL
D5AB86_______________MNPVRTLGPAIAAGNYKGIWIYLLAPVVGALCGAAGYTVVRL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain