UniGene Name: sp_v3.0_unigene63584
Length: 168 nt
UniGene Fasta |
---|
>sp_v3.0_unigene63584
C |
Ace file of the UniGene sp_v3.0_unigene63584 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9LXF2.2|PP385_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g15300 gb|AED92145.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | - | - | 2.0e-14 | 62% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 74% |
Source | Gene names |
---|---|
Sma3 | At3g49170; At4g13650; At4g33170; At5g09950; At5g15300; At5g40410; EMB2261; F18A5.40; F2K15.30; F4I10.100; F8M21_190; GSVIVT00005103001; GSVIVT00006516001; GSVIVT00006853001; GSVIVT00006973001; GSVIVT00007922001; GSVIVT00008739001; GSVIVT00011403001; GSVIV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF221 | IPR003864 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | IPR011523 | - | 0.0 | - | |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G15300.1 | Pentatricopeptide repeat (PPR) superfamily protein chr5:4968384-4970030 REVERSE LENGTH=548 | 2.0e-19 | 62% |
RefSeq | Arabidopsis thaliana | NP_197034.2 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-19 | 62% |
RefSeq | Populus trichocarpa | XP_002324070.1 | predicted protein [Populus trichocarpa] | 8.0e-20 | 66% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: Distance to subject end: 150 aas, your sequence is shorter than subject: 56 - 246
Fln protein:
P
Protein Length:
57
Fln nts:
C
Fln Alignment:
G5KS2UX02G6A8L___PGALVWRTLLGACRVYGNMELGKRAAERLLELEPNDAASYVLLSNIYAAAGRWDD
D5AAE0_______________PDANVWGALLGACRMYGNIDLGKHAAECLFQLEPHNAAKYVLLSNIYAAAGRWDD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain