UniGene Name: sp_v3.0_unigene63496
Length: 207 nt
UniGene Fasta |
---|
>sp_v3.0_unigene63496
A |
Ace file of the UniGene sp_v3.0_unigene63496 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase | - | - | 3.0e-15 | 44% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 59% |
Sma3 | UDP-glucuronosyltransferase, putative | - | - | 1.477e-25 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Anthocyanidin 3-O-glucosyltransferase. | EC:2.4.1.115 | - | 5.145e-23 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Anthocyanin biosynthesis | 00942 | 5.145e-23 | % | |
Sma3 | Metabolic pathways | 01100 | 5.145e-23 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 5.145e-23 | % |
Source | Gene names |
---|---|
Sma3 | 170F8.16; 170F8.17; 170F8.18; 170F8.19; AdGt-14; AdGt-9; At2g36760; At2g36770; At2g36780; At2g36790; At2g36800; At3g02100; CtGT4; DOGT1; DcA82; Eg5GT-A; Eg5GT-B; F13K3.19; F13K3.20; F1C9.11; GSVIVT00001990001; GSVIVT00008150001; GSVIVT00013563001; GSVIVT0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | - |
Sma3 | UDP-glucosyltransferase activity | GO:0035251 | Molecular Function | 0.0 | - |
Sma3 | trans-zeatin O-beta-D-glucosyltransferase activity | GO:0050403 | Molecular Function | 0.0 | - |
Sma3 | cis-zeatin O-beta-D-glucosyltransferase activity | GO:0050502 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | brassinosteroid metabolic process | GO:0016131 | Biological Process | 0.0 | - |
Sma3 | flavonol biosynthetic process | GO:0051555 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | UDP-glucuronosyl/UDP-glucosyltransferase | IPR002213 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G15480.1 | UGT84A1 UDP-Glycosyltransferase superfamily protein chr4:8849000-8850472 REVERSE LENGTH=490 | 1.0e-21 | 53% |
RefSeq | Arabidopsis thaliana | NP_193283.2 | UDP-glycosyltransferase-like protein [Arabidopsis thaliana] | 2.0e-21 | 53% |
RefSeq | Populus trichocarpa | XP_002314683.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-27 | 60% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVW6
Fln msg: Distance to subject end: 71 aas, your sequence is shorter than subject: 69 - 487
Fln protein:
N
Protein Length:
70
Fln nts:
A
Fln Alignment:
G5KS2UX02FSL25___GCLVSWCPQLLGFLSHPSIACFLTHCGWNSALESITMGVPMLCWPYFGDQFVNQCYIVHVWKIG
A9NVW6_______________GLVVPWCNQLQ-VLSHPSVAGFITHCGWNSMLESIALGVPMIGFPFWADQFTNSKLMAHEWKIG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain