UniGene Name: sp_v3.0_unigene63481
Length: 149 nt
![]() |
---|
>sp_v3.0_unigene63481
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Serine hydroxymethyltransferase n=2 Tax=Drosophila RepID=B4MEL9_DROVI | - | - | 6.0e-17 | 93% |
FL-Next | sp=Serine hydroxymethyltransferase; Pinus pinaster (Maritime pine). | - | - | 0.0 | 69% |
Sma3 | Serine hydroxymethyltransferase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycine hydroxymethyltransferase. | EC:2.1.2.1 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycine, serine and threonine metabolism | 00260 | 0.0 | % | |
Sma3 | Cyanoamino acid metabolism | 00460 | 0.0 | % | |
Sma3 | One carbon pool by folate | 00670 | 0.0 | % | |
Sma3 | Methane metabolism | 00680 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | AT4g32520; AT5G26780; At4g37930; At5g26780; CHLREDRAFT_194461; CHLREDRAFT_196400; F20D10.50; F8B4.220; GSVIVT00004194001; GSVIVT00005332001; GSVIVT00008486001; GSVIVT00010127001; GSVIVT00015058001; GSVIVT00032161001; LOC_Os03g52840; MICPUCDRAFT_49634; MIC |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | glycine hydroxymethyltransferase activity | GO:0004372 | Molecular Function | 0.0 | - |
Sma3 | poly(U) RNA binding | GO:0008266 | Molecular Function | 0.0 | - |
Sma3 | pyridoxal phosphate binding | GO:0030170 | Molecular Function | 0.0 | - |
Sma3 | glycine metabolic process | GO:0006544 | Biological Process | 0.0 | - |
Sma3 | L-serine metabolic process | GO:0006563 | Biological Process | 0.0 | - |
Sma3 | one-carbon metabolic process | GO:0006730 | Biological Process | 0.0 | - |
Sma3 | oxygen and reactive oxygen species metabolic process | GO:0006800 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | plant-type hypersensitive response | GO:0009626 | Biological Process | 0.0 | - |
Sma3 | photorespiration | GO:0009853 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Serine hydroxymethyltransferase | IPR001085 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 1 | IPR015421 | - | 0.0 | - |
Sma3 | Pyridoxal phosphate-dependent transferase, major region, subdomain 2 | IPR015422 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G37930.1 | SHM1, STM, SHMT1 serine transhydroxymethyltransferase 1 chr4:17831891-17834742 REVERSE LENGTH=517 | 3.0e-15 | 68% |
RefSeq | Arabidopsis thaliana | NP_195506.1 | glycine hydroxymethyltransferase [Arabidopsis thaliana] | 4.0e-15 | 68% |
RefSeq | Populus trichocarpa | XP_002310916.1 | precursor of transferase serine hydroxymethyltransferase 2, partial [Populus trichocarpa] | 2.0e-15 | 68% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: G3C8Z4
Fln msg: Distance to subject end: 73 aas, your sequence is shorter than subject: 49 - 523
Fln protein:
N
Protein Length:
50
Fln nts:
A
Fln Alignment:
G5KS2UX02GUKOK___GAKAELVLEEMHIACNKNTVPGDKSALNPSGIRLGTPALTTRGLVE
G3C8Z4_______________GSRVERVLELVHIAANKNTVPGDISAMVPGGIRMGTPALTSRGFVE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain