UniGene Name: sp_v3.0_unigene63377
Length: 217 nt
UniGene Fasta |
---|
>sp_v3.0_unigene63377
A |
Ace file of the UniGene sp_v3.0_unigene63377 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | AKT1-like K+ channel LilKT1 n=1 Tax=Lilium longiflorum RepID=A3RG92_LILLO | - | - | 1.0e-25 | 74% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
Sma3 | Potassium channel | - | - | 6.912e-25 | - |
Source | Gene names |
---|---|
Sma3 | AKT1; AKT2; AKT3; AT2G26650; At2g26650; At4g18290; At4g22200; At5g46240; DKT1; EcKT1-1; EcKT1-2; F18A8.2; GSVIVT00008671001; GSVIVT00016836001; GSVIVT00026473001; GSVIVT00032550001; GSVIVT00032597001; K2; KAT1; KAT2; KPe1; KST1; KZM2; LKT1; MPL12.2; NKC1; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | ion channel activity | GO:0005216 | Molecular Function | 0.0 | - |
Sma3 | inward rectifier potassium channel activity | GO:0005242 | Molecular Function | 0.0 | - |
Sma3 | voltage-gated potassium channel activity | GO:0005249 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
Sma3 | ion transport | GO:0006811 | Biological Process | 0.0 | - |
Sma3 | potassium ion transport | GO:0006813 | Biological Process | 0.0 | - |
Sma3 | circadian rhythm | GO:0007623 | Biological Process | 0.0 | - |
Sma3 | response to high light intensity | GO:0009644 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | stomatal movement | GO:0010118 | Biological Process | 0.0 | - |
Sma3 | regulation of membrane potential | GO:0042391 | Biological Process | 0.0 | - |
Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cyclic nucleotide-binding domain | IPR000595 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
Sma3 | Potassium channel, voltage-dependent, EAG/ELK/ERG | IPR003938 | - | 0.0 | - |
Sma3 | Ion transport | IPR005821 | - | 0.0 | - |
Sma3 | Ion transport 2 | IPR013099 | - | 0.0 | - |
Sma3 | RmlC-like jelly roll fold | IPR014710 | - | 0.0 | - |
Sma3 | Cyclic nucleotide-binding, conserved site | IPR018488 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G18290.1 | KAT2 potassium channel in Arabidopsis thaliana 2 chr4:10115418-10118477 FORWARD LENGTH=697 | 8.0e-31 | 69% |
RefSeq | Arabidopsis thaliana | NP_193563.3 | Potassium channel KAT2 [Arabidopsis thaliana] | 1.0e-30 | 69% |
RefSeq | Populus trichocarpa | XP_002305337.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-30 | 72% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPV4
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 354 aas, your sequence is shorter than subject: 72 - 659
Fln protein:
N
Protein Length:
73
Fln nts:
A
Fln Alignment:
G5KS2UX02JR6FW___VTLFAVHCAGCFSYLLAARYRDPSRTWIGAAFPHFMKQSLWIRYITAIYFAITTLTTVGYGDLHAEN
B8LPV4_______________VTLFAVHCAGCLYYLLAIWYPNQNNTWIGSRVPEFQQKSFWIRYISCIYWSITTLSTVGYGDIHAVN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain