UniGene Name: sp_v3.0_unigene63370
Length: 246 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene63370
T |
Ace file of the UniGene sp_v3.0_unigene63370 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pentatricopeptide repeat protein 78 (Fragment) n=1 Tax=Funaria hygrometrica RepID=F5CAE0_FUNHY | - | - | 6.0e-24 | 84% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Sma3 | Tetratricopeptide-like helical | - | - | 2.703e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g04840; At1g09410; At1g20230; At1g47580; At1g56690; At2g22070; At3g02010; At3g03580; At3g12770; At3g23330; At3g24000; At3g26782; At3g46790; At3g49170; At3g57430; At3g62890; At4g14050; At4g30700; At4g33170; At4g33990; At4g37380; At5g09950; At5g66520; B1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | acireductone synthase activity | GO:0043874 | Molecular Function | 0.0 | - |
| Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
| Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | L-methionine salvage from methylthioadenosine | GO:0019509 | Biological Process | 0.0 | - |
| Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
| Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G30700.1 | Pentatricopeptide repeat (PPR) superfamily protein chr4:14962617-14964995 REVERSE LENGTH=792 | 2.0e-26 | 75% |
| RefSeq | Arabidopsis thaliana | NP_194799.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-26 | 75% |
| RefSeq | Populus trichocarpa | XP_002300569.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-27 | 77% |
Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: your sequence is shorter than subject: 59 - 246
Fln protein:
I
Protein Length:
60
Fln nts:
T
Fln Alignment:
G5KS2UX02IEBJT___ISTLPGIPIRIMKNLRVCGDCHTATKFISKIVQREIIIRDANRFHHFKDGLCSCGDYW
D5AAE0_______________ISTLPGLPVRIIKNLRVCGDCHTATKFISKIVEREIIIRDANRFHHFKDGLCSCGDYW

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)