|
||||||
|
UniGene Name: sp_v3.0_unigene63300
Length: 188 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene63300
A |
|
Ace file of the UniGene sp_v3.0_unigene63300
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RVT_2 domain containing protein | - | - | 1.0e-28 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
| Source | Gene names |
|---|---|
| Sma3 | LOC_Os10g29650; Os08g0384400; P0605G01.12; RT; VITISV_004365; VITISV_006541; VITISV_006799; VITISV_007267; VITISV_011263; VITISV_015023; VITISV_020105; VITISV_025054; VITISV_027998; VITISV_029672; VITISV_032980; VITISV_034932; VITISV_036622; VITISV_039129 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
| Sma3 | iron-sulfur cluster binding | GO:0051536 | Molecular Function | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 4Fe-4S binding domain | IPR001450 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Uncharacterised protein family Cys-rich | IPR006461 | - | 0.0 | - |
| Sma3 | RNase L inhibitor RLI, possible metal-binding domain | IPR007209 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | ABC transporter, ABCE | IPR013283 | - | 0.0 | - |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Sma3 | 4Fe-4S ferredoxin-type, iron-sulpur binding domain | IPR017896 | - | 0.0 | - |
| Sma3 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site | IPR017900 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G23160.1 | CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 chr4:12129485-12134086 FORWARD LENGTH=1262 | 8.0e-17 | 48% |
| RefSeq | Arabidopsis thaliana | NP_194047.2 | cysteine-rich receptor-like protein kinase 8 [Arabidopsis thaliana] | 1.0e-16 | 48% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 269 aas, your sequence is shorter than subject: 62 - 363
Fln protein:
N
Protein Length:
63
Fln nts:
A
Fln Alignment:
G5KS2UX02H9OBF___KYKANGTLDKYKARLVA*GFSQKEGIDYDETFAPTTKMSIIRLVFALAAQFSWTIHQMD
B8LKV8_______________KYKANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAIAAQHNWKVYQMD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
