UniGene Name: sp_v3.0_unigene63286
Length: 150 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene63286
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative sinapyl alcohol dehydrogenase (Fragment) n=1 Tax=Cedrus deodara RepID=E5F5N8_CEDDE | - | - | 9.0e-13 | 89% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
Sma3 | Cinnamyl alcohol dehydrogenase-like protein | - | - | 5.159e-32 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cinnamyl-alcohol dehydrogenase. | EC:1.1.1.195 | - | 9.011e-15 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phenylpropanoid biosynthesis | 00940 | 9.011e-15 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 9.011e-15 | % | |
Sma3 | Metabolic pathways | 01100 | 9.011e-15 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 9.011e-15 | % | |
Sma3 | Mannitol dehydrogenase. | EC:1.1.1.255 | - | 4.17587e-43 | - |
Source | Gene names |
---|---|
Sma3 | AT2G21730; AT2G21890; AT4G37970; AT4G37980; AT4G39330; AT4g37970; At1g72680; At2g21730; At2g21890; At4g37970; At4g37980; At4g37990; At4g39330; AtCAD1; CAD; CAD1; CAD2; CAD3; CAD6; CAD7; CAD8; CADL1; CADL10; CADL11; CADL2; CADL3; CADL4; CADL5; CADL6; CADL7 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | GO:0016616 | Molecular Function | 0.0 | - |
Sma3 | cinnamyl-alcohol dehydrogenase activity | GO:0045551 | Molecular Function | 0.0 | - |
Sma3 | mannitol dehydrogenase activity | GO:0046029 | Molecular Function | 0.0 | - |
Sma3 | cofactor binding | GO:0048037 | Molecular Function | 0.0 | - |
Sma3 | response to bacterium | GO:0009617 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
Sma3 | D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding | IPR006140 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | 4Fe-4S ferredoxin, iron-sulphur binding, conserved site | IPR017900 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G37990.1 | ELI3-2, ELI3, ATCAD8, CAD-B2 elicitor-activated gene 3-2 chr4:17855964-17857388 FORWARD LENGTH=359 | 3.0e-13 | 72% |
RefSeq | Arabidopsis thaliana | NP_001031812.1 | putative cinnamyl alcohol dehydrogenase 9 [Arabidopsis thaliana] | 3.0e-13 | 75% |
RefSeq | Populus trichocarpa | XP_002300211.1 | cinnamyl alcohol dehydrogenase-like protein [Populus trichocarpa] | 1.0e-13 | 70% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NZE7
Fln msg: Distance to subject end: 165 aas, your sequence is shorter than subject: 49 - 364
Fln protein:
V
Protein Length:
50
Fln nts:
T
Fln Alignment:
G5KS2UX02J50ZR___VVKVPENLPLDATAPLLCAGITVYSPMKYFQMTEPGKS
A9NZE7_______________VVKIPECLPFDAAAPLLCAGITVYSPMKYFQMTEPGKS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain