UniGene Name: sp_v3.0_unigene63195
Length: 151 nt
UniGene Fasta |
---|
>sp_v3.0_unigene63195
A |
Ace file of the UniGene sp_v3.0_unigene63195 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Integrase n=1 Tax=Populus trichocarpa RepID=Q0ZCD0_POPTR | - | - | 6.0e-11 | 64% |
FL-Next | tr=Integrase; subsp. trichocarpa). | - | - | 0.0 | 64% |
Source | Gene names |
---|---|
Sma3 | GSVIVT00005459001; GSVIVT00009118001; VITISV_000420; VITISV_000545; VITISV_001880; VITISV_002055; VITISV_002893; VITISV_003071; VITISV_004753; VITISV_005022; VITISV_005267; VITISV_005489; VITISV_005775; VITISV_005871; VITISV_005876; VITISV_006788; VITISV_ |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Heat shock protein Hsp90 | IPR001404 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Fatty acid hydroxylase | IPR006694 | - | 0.0 | - |
Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Homeobox, conserved site | IPR017970 | - | 0.0 | - |
Sma3 | DNA methylase, N-4 cytosine-specific, conserved site | IPR017985 | - | 0.0 | - |
Sma3 | Aldo/keto reductase, conserved site | IPR018170 | - | 0.0 | - |
Sma3 | Ribosomal protein L33, conserved site | IPR018264 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: Q0ZCD0
Fln msg: Distance to subject end: 455 aas, your sequence is shorter than subject: 50 - 1139
Fln protein:
N
Protein Length:
51
Fln nts:
A
Fln Alignment:
G5KS2UX02JA3RQ___WNLPFQISTDASDTAIGAVLGQEEDKRPYVIYYISKVWLPAELNYTVT
Q0ZCD0_______________WSLPFEIMCDASDYAVGAVLGQRKDKKPYVIYYASKTLNSAQMNYTTT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain