UniGene Name: sp_v3.0_unigene63169
Length: 244 nt
![]() |
---|
>sp_v3.0_unigene63169
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | protein kinase-like protein [Arabidopsis thaliana] dbj|BAB09477.1| casein kinase-like protein [Arabidopsis thaliana] gb|AED92517.1| protein kinase-like protein [Arabidopsis thaliana] | - | - | 6.0e-30 | 92% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 78% |
Sma3 | Casein kinase, putative | - | - | 8.561e-36 | - |
Source | Gene names |
---|---|
Sma3 | AT4g14340; AT4g28540; At1g04440; At2g25760; At3g03940; At3g13670; At3g23340; At4g14340; At4g28540; At5g18190; At5g43320; At5g44100; B1046G12.17-1; B1114B07.27-1; B1114B07.27-3; CHLREDRAFT_153736; CHLREDRAFT_15736; CK1; CKI1; CKI2; CKL10; CKL11; CKL13; CKL |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasmodesma | GO:0009506 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to brassinosteroid stimulus | GO:0009741 | Biological Process | 0.0 | - |
Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
Sma3 | auxin metabolic process | GO:0009850 | Biological Process | 0.0 | - |
Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Alpha-isopropylmalate/homocitrate synthase, conserved site | IPR002034 | - | 0.0 | - |
Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
Sma3 | Cyclin, C-terminal | IPR004367 | - | 0.0 | - |
Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
Sma3 | IPR006670 | - | 0.0 | - | |
Sma3 | Cyclin, N-terminal | IPR006671 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Cyclin-like | IPR013763 | - | 0.0 | - |
Sma3 | Translation elongation factor P/YeiP, conserved site | IPR013852 | - | 0.0 | - |
Sma3 | IPR015706 | - | 0.0 | - | |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G18190.1 | Protein kinase family protein chr5:6010215-6013724 REVERSE LENGTH=691 | 4.0e-32 | 92% |
RefSeq | Arabidopsis thaliana | NP_197320.1 | protein kinase-like protein [Arabidopsis thaliana] | 5.0e-32 | 92% |
RefSeq | Populus trichocarpa | XP_002324211.1 | predicted protein [Populus trichocarpa] | 6.0e-32 | 94% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AA41
Fln msg: Separated hits, possible frame ERROR between 76 and 90, Distance to subject end: 335 aas, atg_distance in limit (1-15): atg_distance = 4, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 79 - 444
Fln protein:
F
Protein Length:
80
Fln nts:
A
Fln Alignment:
G5KS2UX02JB97U___FVHGDIKPENFLLGPPGTSDEKKxxxxxDIFRGTVRYASVHAHLGRTGSRRDDLESLAYTLIFLLRGRLPWQGYQGDTK
D5AA41_______________YVHGDVKPENFLLGQPGTPDEKRxxxxxDVFRGTVRYASVHAHLGRTSSRRDDLESLAYTLIFLLRGRLPWQGYQGDNK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain