UniGene Name: sp_v3.0_unigene63063
Length: 216 nt
UniGene Fasta |
---|
>sp_v3.0_unigene63063
A |
Ace file of the UniGene sp_v3.0_unigene63063 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Gag-pol polyprotein n=2 Tax=Populus RepID=Q710T7_POPDE | - | - | 2.0e-17 | 56% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 52% |
Source | Gene names |
---|---|
Sma3 | 60I2G14; At2g15650; LOC_Os03g61660; LOC_Os10g01750; LOC_Os10g29650; LOC_Os12g05520; LOC_Os12g44200; OSIGBa0134J07.9; OSJNBa0065H03.10; OSJNBa0078D06.27; Os10g0106900; VITISV_010987; VITISV_015847; VITISV_033245; VITISV_033646; VITISV_035210; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | iron-sulfur cluster binding | GO:0051536 | Molecular Function | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 282 aas, atg_distance in limit (1-15): atg_distance = 10, your sequence is shorter than subject: 71 - 363
Fln protein:
M
Protein Length:
72
Fln nts:
A
Fln Alignment:
G5KS2UX02H2TRD___DVWEVVPIPKDKSVVTSKWIYKIKHGAYGSVEKYKARFVARRFSQKEGVDYDEIFAPVARYTTIRSIIA
B8LKV8_______________DTWDLVDLPKEKECISVKWVYKTKYKANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain