|
||||||
|
UniGene Name: sp_v3.0_unigene62964
Length: 220 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene62964
A |
|
Ace file of the UniGene sp_v3.0_unigene62964 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 63% |
| Sma3 | Pentatricopeptide, putative | - | - | 1.288e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g15510; At1g68930; At1g74600; At2g13600; At3g24000; At3g26782; At3g49170; At4g02750; At4g33990; At5g39350; B1032F05.19; EMB2261; EMB2758; F14O13.19; F17I5.180; F1M20.28; F2K15.30; GSVIVT00000282001; GSVIVT00000887001; GSVIVT00002188001; GSVIVT000030600 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | lipid binding | GO:0008289 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | lipid transport | GO:0006869 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G13600.1 | Pentatricopeptide repeat (PPR) superfamily protein chr2:5671493-5673586 FORWARD LENGTH=697 | 8.0e-27 | 54% |
| RefSeq | Arabidopsis thaliana | NP_178983.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-26 | 54% |
| RefSeq | Populus trichocarpa | XP_002310520.1 | predicted protein [Populus trichocarpa] | 5.0e-26 | 56% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: Distance to subject end: 149 aas, your sequence is shorter than subject: 73 - 246
Fln protein:
G
Protein Length:
74
Fln nts:
A
Fln Alignment:
G5KS2UX02IZLLH___GYLDEAKNFINSMPFKPDAIMWGAMLGACRIHSNVELGKWAAEHIFELDPQNSGPYVLLSNIYADAGRWDD
D5AAE0_______________GRLDEARDFMKTIPFAPDANVWGALLGACRMYGNIDLGKHAAECLFQLEPHNAAKYVLLSNIYAAAGRWDD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
