|
||||||
|
UniGene Name: sp_v3.0_unigene62915
Length: 236 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene62915
A |
|
Ace file of the UniGene sp_v3.0_unigene62915
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase short form, putative n=1 Tax=Pediculus humanus corporis RepID=E0VK81_PEDHC | - | - | 7.0e-30 | 92% |
| FL-Next | sp=6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 59% |
| Sma3 | Fructose-6-phosphate 2-kinase/fructose-2,6-bisphosphatase | - | - | 2.471e-19 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 6-phosphofructo-2-kinase. | EC:2.7.1.105 | - | 6.261e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fructose and mannose metabolism | 00051 | 6.261e-11 | % | |
| Sma3 | Fructose-2,6-bisphosphate 2-phosphatase. | EC:3.1.3.46 | - | 8.048e-15 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fructose and mannose metabolism | 00051 | 8.048e-15 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g07110; F10K1.19; F2KP; F2KP1; GSVIVT00024062001; LOC_Os03g18310; OSJNBa0027N19.4; OSJNBb0099P06.14; Os03g0294200; Os05g0164100; OsI_18583; OsJ_10467; OsJ_17237; PHYPADRAFT_146321; PHYPADRAFT_194396; POPTRDRAFT_815458; POPTRDRAFT_821351; RCOM_1668120; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | 6-phosphofructo-2-kinase activity | GO:0003873 | Molecular Function | 0.0 | - |
| Sma3 | fructose-2,6-bisphosphate 2-phosphatase activity | GO:0004331 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
| Sma3 | fructose 2,6-bisphosphate metabolic process | GO:0006003 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR001345 | - | 0.0 | - |
| Sma3 | Carbohydrate binding module family 20 | IPR002044 | - | 0.0 | - |
| Sma3 | Fructose-2,6-bisphosphatase | IPR003094 | - | 0.0 | - |
| Sma3 | Histidine phosphatase superfamily, clade-1 | IPR013078 | - | 0.0 | - |
| Sma3 | 6-phosphofructo-2-kinase | IPR013079 | - | 0.0 | - |
| Sma3 | Immunoglobulin-like fold | IPR013783 | - | 0.0 | - |
| Sma3 | Bifunctional 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphate 2-phosphatase | IPR016260 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G07110.1 | F2KP, ATF2KP, FKFBP fructose-2,6-bisphosphatase chr1:2178363-2183980 REVERSE LENGTH=744 | 3.0e-18 | 63% |
| RefSeq | Arabidopsis thaliana | NP_172191.1 | fructose-2,6-bisphosphatase [Arabidopsis thaliana] | 4.0e-18 | 63% |
| RefSeq | Populus trichocarpa | XP_002298489.1 | predicted protein [Populus trichocarpa] | 5.0e-18 | 61% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9MB58
Fln msg: Separated hits, possible frame ERROR between 72 and 75, Distance to subject end: 41 aas, your sequence is shorter than subject: 79 - 744
Fln protein:
N
Protein Length:
80
Fln nts:
A
Fln Alignment:
G5KS2UX02I9QKQ___KALNEIDAGICEEMTYEEIAENxPEDFASRDEAKFTYRYPRGESYEDLVARLEPVIMELERQ-GNVLVVSHQAVMRCL
Q9MB58_______________RALDEINAGVCDGMTYEEVKKNxPEEYESRKKDKLRYRYPRGESYLDVIQRLEPVIIELERQRAPVVVISHQAVLRAL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
