UniGene Name: sp_v3.0_unigene62846
Length: 167 nt
UniGene Fasta |
---|
>sp_v3.0_unigene62846
A |
Ace file of the UniGene sp_v3.0_unigene62846 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 2.353e-07 | - |
Source | Gene names |
---|---|
Sma3 | At2g36730; At3g15930; At5g19020; F13K3.13; GSVIVT00002423001; GSVIVT00006945001; GSVIVT00007743001; GSVIVT00015978001; GSVIVT00016277001; GSVIVT00016825001; GSVIVT00018056001; GSVIVT00019892001; GSVIVT00020997001; GSVIVT00023390001; GSVIVT00024893001; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | methylation | GO:0032259 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Putative methylase | IPR004557 | - | 0.0 | - |
Sma3 | Protein of unknown function DUF642 | IPR006946 | - | 0.0 | - |
Sma3 | Methyltransferase small | IPR007848 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G19020.1 | MEF18 mitochondrial editing factor 18 chr5:6352771-6354828 REVERSE LENGTH=685 | 5.0e-18 | 64% |
RefSeq | Arabidopsis thaliana | NP_197403.2 | mitochondrial editing factor 18 [Arabidopsis thaliana] | 6.0e-18 | 64% |
RefSeq | Populus trichocarpa | XP_002329756.1 | predicted protein [Populus trichocarpa] | 8.0e-19 | 62% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ0
Fln msg: Distance to subject end: 106 aas, your sequence is shorter than subject: 55 - 644
Fln protein:
N
Protein Length:
56
Fln nts:
A
Fln Alignment:
G5KS2UX02I52DO___PDNITFLGVLSACCHAGLVDKGWQYFRDMSQCHRIKPSMEHYGCMVDLLGR
B8LLJ0_______________PDRVTFVGVLSACCHAGLVDEGRQYFDIMTRFYHITPAMEHYGCMIDLLGR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain