UniGene Name: sp_v3.0_unigene62819
Length: 238 nt
![]() |
---|
>sp_v3.0_unigene62819
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Similarity to 26S proteasome subunit 4 n=2 Tax=Arabidopsis thaliana RepID=Q9LIM2_ARATH | - | - | 6.0e-28 | 80% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 56% |
Sma3 | Bromodomain protein | - | - | 3.642e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Microtubule-severing ATPase. | EC:3.6.4.3 | - | 5.49e-07 | - |
Source | Gene names |
---|---|
Sma3 | AT3G09840; AT4g29040; At2g20140; At3g09840; At3g53230; At3g56690; At4g29040; At5g03340; BRAT1501; BRAT3501; BRD906; BRD911; CAFP; CDC48; CDC48A; CDC48D; CDC48E; CHLREDRAFT_171910; CHLREDRAFT_97976; F12E4_70; F19B15.70; GSVIVT00001933001; GSVIVT00016023001 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | cytoskeleton | GO:0005856 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
Sma3 | protein transport | GO:0015031 | Biological Process | 0.0 | - |
Sma3 | protein catabolic process | GO:0030163 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Ribosomal protein S16 | IPR000307 | - | 0.0 | - |
Sma3 | Peptidase M41 | IPR000642 | - | 0.0 | - |
Sma3 | Bromodomain | IPR001487 | - | 0.0 | - |
Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
Sma3 | CDC48, N-terminal subdomain | IPR003338 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, conserved site | IPR003960 | - | 0.0 | - |
Sma3 | CDC48, domain 2 | IPR004201 | - | 0.0 | - |
Sma3 | 26S proteasome subunit P45 | IPR005937 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, CDC48 | IPR005938 | - | 0.0 | - |
Sma3 | Aspartate decarboxylase-like fold | IPR009010 | - | 0.0 | - |
Sma3 | Peptidase M41, FtsH extracellular | IPR011546 | - | 0.0 | - |
Sma3 | Vps4 oligomerisation, C-terminal | IPR015415 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | Bromodomain, conserved site | IPR018359 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G15120.1 | P-loop containing nucleoside triphosphate hydrolases superfamily protein chr3:5088487-5095482 REVERSE LENGTH=1954 | 2.0e-34 | 80% |
RefSeq | Arabidopsis thaliana | NP_188130.1 | AAA-type ATPase family protein [Arabidopsis thaliana] | 2.0e-34 | 80% |
RefSeq | Populus trichocarpa | XP_002317012.1 | predicted protein, partial [Populus trichocarpa] | 9.0e-33 | 85% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACE6
Fln msg: Distance to subject end: 74 aas, your sequence is shorter than subject: 79 - 442
Fln protein:
N
Protein Length:
80
Fln nts:
A
Fln Alignment:
G5KS2UX02JYECP___VVSTLLALMDGLKPRGSIVVIGATNRPEDLDPALRRPGRFDREIYFPLPSVKDREAILHVHTRKWP
D5ACE6_______________VMSQLLVEMDGLNPRIGVTVIAATNRPDKIDAALMRPGRFDRLVYVGLPNQADRKEIFDIHMRKMP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain