UniGene Name: sp_v3.0_unigene62678
Length: 180 nt
UniGene Fasta |
---|
>sp_v3.0_unigene62678
A |
Ace file of the UniGene sp_v3.0_unigene62678 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Reverse transcriptase; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 63% |
Sma3 | Gag-Pol polyprotein | - | - | 9.556e-07 | - |
Source | Gene names |
---|---|
Sma3 | At2g15700; H0515C11.7; LOC_Os10g01450; LOC_Os11g03830; LOC_Os11g05840; LOC_Os12g23320; LYC_68t000004; OSJNBa0071K19.3; OSJNBa0079H23.15; OSJNBa0096E22.13; OSJNBb0012E08.6; Os02g0776400; Os08g0518300; Os11g0157000; P0010D04.5; Rtsp-1AA; SUNLYC_67t000007; V |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | phosphopyruvate hydratase complex | GO:0000015 | Cellular Component | 0.0 | - |
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | dihydrofolate reductase activity | GO:0004146 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
Sma3 | exonuclease activity | GO:0004527 | Molecular Function | 0.0 | - |
Sma3 | phosphopyruvate hydratase activity | GO:0004634 | Molecular Function | 0.0 | - |
Sma3 | ionotropic glutamate receptor activity | GO:0004970 | Molecular Function | 0.0 | - |
Sma3 | extracellular-glutamate-gated ion channel activity | GO:0005234 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | glycine biosynthetic process | GO:0006545 | Biological Process | 0.0 | - |
Sma3 | apoptotic process | GO:0006915 | Biological Process | 0.0 | - |
Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
Sma3 | nucleotide biosynthetic process | GO:0009165 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | transposition | GO:0032196 | Biological Process | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q9M5J7
Fln msg: Distance to subject end: 116 aas, your sequence is shorter than subject: 59 - 542
Fln protein:
C
Protein Length:
60
Fln nts:
A
Fln Alignment:
G5KS2UX02GOWN3___PYANFGGNLMYAMVSTRPDISHAVGVVSRFMSNLGEEHW*AMKWVLRYLRGTSDH
Q9M5J7_______________PYASAVGSLMYAMVCTRPDIAHAVGFLSRYMSKLGKEHWTTVKRVFRYLHGTTSY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain