|
||||||
|
UniGene Name: sp_v3.0_unigene62590
Length: 215 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene62590
A |
|
Ace file of the UniGene sp_v3.0_unigene62590
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | calnexin [Glycine max] | - | - | 5.0e-24 | 51% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 49% |
| Sma3 | Calnexin homolog | - | - | 6.725e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g61790; CNX; CNX1; GSVIVT00006229001; GSVIVT00011650001; Gm cnx-1; LeCNX61.0; MAC9.11; OSJNBb0012E08.10; Os04g0402100; OsI_15749; OsJ_14665; PHYPADRAFT_118597; PHYPADRAFT_191189; PHYPADRAFT_59289; POPTRDRAFT_733819; POPTRDRAFT_823453; RCOM_1503060; VIT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | unfolded protein binding | GO:0051082 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Calreticulin/calnexin | IPR001580 | - | 0.0 | - |
| Sma3 | Calreticulin/calnexin, P | IPR009033 | - | 0.0 | - |
| Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
| Sma3 | Calreticulin/calnexin, conserved site | IPR018124 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G61790.1 | CNX1, ATCNX1 calnexin 1 chr5:24827394-24829642 REVERSE LENGTH=530 | 4.0e-28 | 48% |
| RefSeq | Arabidopsis thaliana | NP_200987.1 | calnexin 1 [Arabidopsis thaliana] | 5.0e-28 | 48% |
| RefSeq | Populus trichocarpa | XP_002321768.1 | predicted protein [Populus trichocarpa] | 9.0e-28 | 48% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PT78
Fln msg: Distance to subject end: 306 aas, your sequence is shorter than subject: 71 - 549
Fln protein:
M
Protein Length:
72
Fln nts:
A
Fln Alignment:
G5KS2UX02JK80J___SIMFGPDKCGSTNKVHFIFRHKHPKTDKYVEHHLKYPPVPTADRVTHIYTAIIY-------------------------------------PDDKKPEDWDERAKIP
C0PT78_______________SIMFGPDKCGATNKVHFIYKHKNPKSGEYVEHHLKYPPSTPSDKLTHVYTAILKPNNEVRILIDGEEKKKANLLSGDDFEPALIPPETIPDPEDKKPEDWDERAKIP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
