|
||||||
|
UniGene Name: sp_v3.0_unigene62049
Length: 245 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene62049
A |
|
Ace file of the UniGene sp_v3.0_unigene62049
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative polyprotein n=1 Tax=Oryza sativa Japonica Group RepID=Q6I578_ORYSJ | - | - | 2.0e-19 | 56% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 56% |
| Sma3 | Retrotransposon protein, putative, Ty1-copia subclass | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g04490; B1110B01.13; H0211A12.10; H0716A07.9; LOC_Os03g11850; LOC_Os03g14060; LOC_Os03g20080; LOC_Os03g21050; LOC_Os03g29130; LOC_Os03g30450; LOC_Os03g31134; LOC_Os03g33640; LOC_Os03g36610; LOC_Os03g41000; LOC_Os03g43610; LOC_Os03g44280; LOC_Os03g53560 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nuclear pore | GO:0005643 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | acid phosphatase activity | GO:0003993 | Molecular Function | 0.0 | - |
| Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | protein transporter activity | GO:0008565 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
| Sma3 | protein import into nucleus, docking | GO:0000059 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Importin-beta, N-terminal | IPR001494 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | Acid phosphatase (Class B) | IPR005519 | - | 0.0 | - |
| Sma3 | Rhamnogalacturonate lyase | IPR010325 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF1263 | IPR010685 | - | 0.0 | - |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Berberine/berberine-like | IPR012951 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Exportin-1/Importin-beta-like | IPR013598 | - | 0.0 | - |
| Sma3 | CRM1 C-terminal domain | IPR014877 | - | 0.0 | - |
| Sma3 | FAD-binding, type 2 | IPR016166 | - | 0.0 | - |
| Sma3 | F-box associated interaction domain | IPR017451 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Distance to subject end: 259 aas, your sequence is shorter than subject: 81 - 363
Fln protein:
C
Protein Length:
82
Fln nts:
A
Fln Alignment:
G5KS2UX02HV7F9___IGCKWVYKNKCKVDGSLDKHKAKLMEKCFA*KEGVDYEDTFSTIAKWLTIHTLFSLAAQNGWKVHQMDVKTYFLNG
B8LKV8_______________ISVKWVYKTKYKANGELDKHKARLVAKGFAQEYGVDYNETFAPVARLDTIRMVLAIAAQHNWKVYQMDVKSAFLNG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
