UniGene Name: sp_v3.0_unigene62028
Length: 229 nt
UniGene Fasta |
---|
>sp_v3.0_unigene62028
A |
Ace file of the UniGene sp_v3.0_unigene62028 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Carotenoid isomerase n=1 Tax=Chrysanthemum x morifolium RepID=Q2HXK3_CHRMO | - | - | 1.0e-14 | 90% |
FL-Next | sp=Prolycopene isomerase 2, chloroplastic; Oncidium hybrid cultivar (Orchid). | - | - | 0.0 | 88% |
Sma3 | CrtISO | - | - | 1.216e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | EC:5.-.-.- | - | 6.428e-16 | - |
Source | Gene names |
---|---|
Sma3 | At1g06820; CCR2; CHLREDRAFT_196597; CRTISO; CRTISO1; CRTISO2; F4H5.10; GSVIVT00027139001; LOC_Os11g36440; Os11g0572700; OsI_36549; OsJ_34321; PHYPADRAFT_194048; POPTRDRAFT_866125; POPTRDRAFT_904781; RCOM_0422660; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | isomerase activity | GO:0016853 | Molecular Function | 0.0 | - |
Sma3 | carotenoid isomerase activity | GO:0046608 | Molecular Function | 0.0 | - |
Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
Sma3 | tRNA processing | GO:0008033 | Biological Process | 0.0 | - |
Sma3 | etioplast organization | GO:0009662 | Biological Process | 0.0 | - |
Sma3 | carotenoid biosynthetic process | GO:0016117 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA-binding protein Dps | IPR002177 | - | 0.0 | - |
Sma3 | Glucose-inhibited division protein A-related | IPR002218 | - | 0.0 | - |
Sma3 | Aromatic-ring hydroxylase-like | IPR003042 | - | 0.0 | - |
Sma3 | Fumarate reductase/succinate dehydrogenase flavoprotein, N-terminal | IPR003953 | - | 0.0 | - |
Sma3 | FAD dependent oxidoreductase | IPR006076 | - | 0.0 | - |
Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
Sma3 | Carotene isomerase | IPR014101 | - | 0.0 | - |
Sma3 | Chaperonin Cpn60, conserved site | IPR018370 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G06820.1 | CRTISO, CCR2 carotenoid isomerase chr1:2093145-2096220 REVERSE LENGTH=595 | 1.0e-18 | 88% |
RefSeq | Arabidopsis thaliana | NP_172167.2 | carotenoid isomerase [Arabidopsis thaliana] | 2.0e-18 | 88% |
RefSeq | Populus trichocarpa | XP_002308337.1 | predicted protein [Populus trichocarpa] | 4.0e-19 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q52QW2
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 423 aas, your sequence is shorter than subject: 73 - 587
Fln protein:
N
Protein Length:
74
Fln nts:
A
Fln Alignment:
G5KS2UX02I03OD___VKGARVLVLEKYVILGGSSGFYKRDGYTFDVGSSVMFGFSDKMN
Q52QW2_______________VKGARVLVLEKYVIPGGSSGFFQRDGFTFDVGSSVMFGFSDKGN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain