|
||||||
|
UniGene Name: sp_v3.0_unigene62013
Length: 235 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene62013
A |
|
Ace file of the UniGene sp_v3.0_unigene62013
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Reverse transcriptase (Fragment) n=1 Tax=Picea abies RepID=Q9FY10_PICAB | - | - | 1.0e-17 | 61% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
| Sma3 | Retrotransposon protein, putative, unclassified | - | - | 3.319e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g05390; At2g05960; F11I4_21; F28G4.2; LOC_Os03g38850; LOC_Os10g12760; LOC_Os10g26830; LOC_Os10g41610; LOC_Os11g25690; LOC_Os11g44190; LOC_Os12g06530; LOC_Os12g10900; LOC_Os12g26400; LOC_Os12g27120; LOC_Os12g35880; OJ000114_01.9; OJ1006F06.13; OSJNBa000 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
| Sma3 | GPI anchor biosynthetic process | GO:0006506 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Ankyrin repeat | IPR002110 | - | 0.0 | - |
| Sma3 | HhH-GPD domain | IPR003265 | - | 0.0 | - |
| Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
| Sma3 | GPI biosynthesis protein Pig-F | IPR009580 | - | 0.0 | - |
| Sma3 | DNA helicase PIF1, ATP-dependent | IPR010285 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF1785 | IPR014811 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKV8
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 227 aas, your sequence is shorter than subject: 61 - 363
Fln protein:
C
Protein Length:
62
Fln nts:
A
Fln Alignment:
G5KS2UX02G2BKI___IDYDVIFAPIARYTTIRLIIALVASQGWNLHQMDVKTIFLHGSIKEEVYVEQPKGFE
B8LKV8_______________VDYNETFAPVARLDTIRMVLAIAAQHNWKVYQMDVKSAFLNGYLEEEVYVQQPPRYE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
