UniGene Name: sp_v3.0_unigene61747
Length: 240 nt
![]() |
---|
>sp_v3.0_unigene61747
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Integrase n=1 Tax=Boechera divaricarpa RepID=B6REL8_9BRAS | - | - | 3.0e-20 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
Sma3 | Retrotransposon protein, putative, unclassified | - | - | 8.201e-12 | - |
Source | Gene names |
---|---|
Sma3 | 117M18_33; B1110B01.4; F11I4_21; F28G4.2; F28H19.6; LOC_Os03g05850; LOC_Os03g26290; LOC_Os03g26570; LOC_Os03g47410; LOC_Os03g61660; LOC_Os10g01750; LOC_Os10g04074; LOC_Os10g07460; LOC_Os10g17570; LOC_Os10g26030; LOC_Os10g41610; LOC_Os11g09330; LOC_Os11g35 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleotide binding | GO:0000166 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | rRNA N-glycosylase activity | GO:0030598 | Molecular Function | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Sma3 | negative regulation of translation | GO:0017148 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | BRCT domain | IPR001357 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
Sma3 | Phosphotransferase system, HPr serine phosphorylation site | IPR002114 | - | 0.0 | - |
Sma3 | Argonaute/Dicer protein, PAZ | IPR003100 | - | 0.0 | - |
Sma3 | Stem cell self-renewal protein Piwi | IPR003165 | - | 0.0 | - |
Sma3 | HhH-GPD domain | IPR003265 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | IPR010256 | - | 0.0 | - | |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF1785 | IPR014811 | - | 0.0 | - |
Sma3 | Acyl-CoA N-acyltransferase | IPR016181 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKX7
Fln msg: Distance to subject end: 124 aas, your sequence is shorter than subject: 79 - 407
Fln protein:
C
Protein Length:
80
Fln nts:
A
Fln Alignment:
G5KS2UX02F4J32___EFCSSAFSNFCDAHGIKLQLTTPCTPQ*NSVVERRNRTVVEMARSMLQHRNVPNKFWAEAVFTVVYLLNRSPTQAVK
B8LKX7_______________EYVNKEFDHYCKYNGIKREHTVPYTPQQNGVAERKNRTLMEMARCMLHARNMDPKFWAEAINTATYIVNRTPTIAVK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain