UniGene Name: sp_v3.0_unigene61356
Length: 177 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene61356
T |
Ace file of the UniGene sp_v3.0_unigene61356 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Protein kinase PINOID n=3 Tax=Brassicaceae RepID=O64682_ARATH | - | - | 1.0e-13 | 73% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 64% |
Sma3 | Serine/threonine protein kinase, putative | - | - | 2.045e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific serine/threonine protein kinase. | EC:2.7.11.1 | - | 2.468e-10 | - |
Sma3 | Protein kinase C. | EC:2.7.11.13 | - | 9.044e-06 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphatidylinositol signaling system | 04070 | 9.044e-06 | % |
Source | Gene names |
---|---|
Sma3 | AGC1-10; AT4g26610; ATPK64; Adi3; At2g26700; At2g34650; At2g44830; At3g27580; At4g26610; At5g55910; B1026E06.38; B1066D09.24; Bcpk1; GSVIVT00016854001; GSVIVT00020660001; GSVIVT00022055001; GSVIVT00028378001; LOC_Os06g18830; LOC_Os10g41290; LOC_Os12g29580 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | auxin polar transport | GO:0009926 | Biological Process | 0.0 | - |
Sma3 | root hair initiation | GO:0048766 | Biological Process | 0.0 | - |
Sma3 | root hair elongation | GO:0048767 | Biological Process | 0.0 | - |
Sma3 | cotyledon development | GO:0048825 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | AGC-kinase, C-terminal | IPR000961 | - | 0.0 | - |
Sma3 | Zinc finger, RanBP2-type | IPR001876 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G34650.1 | PID, ABR Protein kinase superfamily protein chr2:14589934-14591557 REVERSE LENGTH=438 | 4.0e-16 | 73% |
RefSeq | Arabidopsis thaliana | NP_181012.1 | protein kinase-like protein [Arabidopsis thaliana] | 5.0e-16 | 73% |
RefSeq | Populus trichocarpa | XP_002322241.1 | predicted protein [Populus trichocarpa] | 4.0e-15 | 71% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKY3
Fln msg: Overlapping hits, possible frame ERROR between 126 and 111, Unexpected STOP codon at 3' end. Distance to subject end: 273 aas, your sequence is shorter than subject: 56 - 545
Fln protein:
F
Protein Length:
57
Fln nts:
T
Fln Alignment:
G5KS2UX02GER0W___FLPTLYAHFEASHYSCLVMEYCAGGDLHSLRLRQHWxxxxxxSARFYAAEVLL
B8LKY3_______________FLPTLYSHFETDKFSCLVMEFCSGGDLHSFRQQQPWxxxxxxASRFYAAEILL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain