UniGene Name: sp_v3.0_unigene61202
Length: 133 nt
UniGene Fasta |
---|
>sp_v3.0_unigene61202
A |
Ace file of the UniGene sp_v3.0_unigene61202 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | serine/threonine kinase receptor precursor-like protein [Oryza sativa Japonica Group] | - | - | 7.0e-10 | 66% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 83% |
Sma3 | Chromosome undetermined scaffold_293, whole genome shotgun sequence | - | - | 7.326e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 7.266e-14 | - |
Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 1.567e-09 | - |
Source | Gene names |
---|---|
Sma3 | AT4g03230; At1g70520; At4g03230; At4g04490; At4g04500; At4g38830; At5g40380; CRK2; CRK26; CRK36; CRK37; CRK42; F24J13.9; F4C21.16; GSVIVT00002762001; GSVIVT00004742001; GSVIVT00004743001; GSVIVT00005156001; GSVIVT00005183001; GSVIVT00010206001; GSVIVT0001 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of cell wall | GO:0005199 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G61380.1 | SD1-29 S-domain-1 29 chr1:22646277-22649401 REVERSE LENGTH=805 | 4.0e-13 | 64% |
RefSeq | Arabidopsis thaliana | NP_564775.1 | protein S-domain-1 29 [Arabidopsis thaliana] | 6.0e-13 | 64% |
RefSeq | Populus trichocarpa | XP_002314608.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-15 | 71% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLL8
Fln msg: Distance to subject end: 180 aas, your sequence is shorter than subject: 43 - 245
Fln protein:
C
Protein Length:
44
Fln nts:
A
Fln Alignment:
G5KS2UX02G795A___RYNIMVGTARGLAYLHEDSTVRIIHRDIKCANILLDERFHPK
B8LLL8_______________RLGIIVGTARGLTYLHEDSNVRIIHRDIKCGNILLDDRFHPK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain