|
||||||
|
UniGene Name: sp_v3.0_unigene61142
Length: 232 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene61142
A |
|
Ace file of the UniGene sp_v3.0_unigene61142
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Triosephosphate isomerase n=2 Tax=Picea sitchensis RepID=A9NUV2_PICSI | - | - | 2.0e-32 | 92% |
| FL-Next | sp=Triosephosphate isomerase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
| Sma3 | Triosephosphate isomerase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Triose-phosphate isomerase. | EC:5.3.1.1 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 0.0 | % | |
| Sma3 | Fructose and mannose metabolism | 00051 | 0.0 | % | |
| Sma3 | Inositol phosphate metabolism | 00562 | 0.0 | % | |
| Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g21170; F26H11.7; GSVIVT00018496001; GSVIVT00024314001; GSVIVT00036055001; MICPUCDRAFT_46562; MICPUN_64258; OJ1112_E07.32-1; Os01g0147900; Os01g0841600; Os09g0535000; OsI_00389; OsI_32171; OsJ_00367; OsJ_04035; P0408C03.42; P0569E11.2-1; PHYPADRAFT_112 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | triose-phosphate isomerase activity | GO:0004807 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | GO:0008415 | Molecular Function | 0.0 | - | |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | reductive pentose-phosphate cycle | GO:0019253 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Triosephosphate isomerase | IPR000652 | - | 0.0 | - |
| Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G21170.1 | TIM, PDTPI triosephosphate isomerase chr2:9071047-9073106 REVERSE LENGTH=315 | 9.0e-38 | 84% |
| RefSeq | Arabidopsis thaliana | NP_001077931.1 | triosephosphate isomerase [Arabidopsis thaliana] | 1.0e-37 | 84% |
| RefSeq | Populus trichocarpa | XP_002306169.1 | predicted protein [Populus trichocarpa] | 6.0e-40 | 88% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LM02
Fln msg: Distance to subject end: 138 aas, your sequence is shorter than subject: 77 - 328
Fln protein:
M
Protein Length:
78
Fln nts:
A
Fln Alignment:
G5KS2UX02HS6KG___PFVYIDQVKSSLIDRFIEISAQNSWVGKGGAFTGEISVEQLNDIGCKWVIHGHSERRHVIGEDNQFIGKKSAYAV
B8LM02_______________PFVYIDQVKSSLTDR-IEISAQNAWVGKGGAFTGEISVEQLKDIGCKWVIHGHSERRHVIGEDSQFIGKKSAYAL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
