UniGene Name: sp_v3.0_unigene60574
Length: 170 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene60574
T |
Ace file of the UniGene sp_v3.0_unigene60574
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | PREDICTED: similar to Tetratricopeptide-like helical n=1 Tax=Vitis vinifera RepID=UPI0001984A05 | - | - | 1.0e-15 | 67% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
| Sma3 | Putative pentatricopeptide (PPR) repeat-containing protein | - | - | 1.407e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g33680; At3g49170; At4g30700; B1032F05.19; DYW9; EMB2261; F2K15.30; GSVIVT00000117001; GSVIVT00002423001; GSVIVT00006467001; GSVIVT00006499001; GSVIVT00006886001; GSVIVT00013497001; GSVIVT00015531001; GSVIVT00015978001; GSVIVT00016225001; GSVIVT0001630 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | mitosis | GO:0007067 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | methylation | GO:0032259 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | DNA-binding HORMA | IPR003511 | - | 0.0 | - |
| Sma3 | Putative methylase | IPR004557 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
| Sma3 | Methyltransferase small | IPR007848 | - | 0.0 | - |
| Sma3 | IPR011523 | - | 0.0 | - | |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G20230.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:7009570-7011852 FORWARD LENGTH=760 | 8.0e-18 | 58% |
| RefSeq | Arabidopsis thaliana | NP_173449.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-17 | 58% |
| RefSeq | Populus trichocarpa | XP_002332237.1 | predicted protein [Populus trichocarpa] | 1.0e-19 | 62% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 212 aas, your sequence is shorter than subject: 56 - 312
Fln protein:
T
Protein Length:
57
Fln nts:
T
Fln Alignment:
F7QVD2L01BPSL6___SVLSACSHAGLVEEGWHYFHCMSQEYSITPQVKQYACMVDLLGRAGHLDEAFEFI
D5ADG9_______________SVLSACSHAGLVDEGWKCYNCMTLDYAITPTVEHYACMVDLLGRAGHLNEAWDFI

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta